KEGG   Addendum: CAK50784
Entry
CAK50784          CDS       T10000                                 

Gene name
mtmC
Definition
(KEGG) D-mycarose 3-C-methyltransferase
  KO
K15962  D-mycarose 3-C-methyltransferase
Taxonomy
TAX:41951
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces argillaceus)
SSDB
Motif
Pfam: Methyltransf_14 Methyltransf_13 Methyltransf_23 Methyltransf_11 Methyltransf_12 Methyltransf_25 PCMT
Other DBs
NCBI-ProteinID: CAK50784
GB: X89899
UniProt: Q194Q4
Structure
PDB: 
4RVD 4RV9 4RVG 4RVH 4RVF

AA seq 420 aa
MDIYGTARAVTTCRMCGAQDWQEVVDFGPVPLADSFLEPAASYDDEPRYPLAVVSCRSCR
LMSLTHVVDPEVLYRTYPYTTSDSETIKKHMGHVVAVCVERFGIPEGSFVLEIGSNTGSQ
LKAFQNAGMRTLGIDPARNIAAVANERGIETLPEFFSVDTAALVKKTHGTPQLVLGRHVF
AHIDDVSAVAEGVRDLLGPDSLFAIEVPYLVDMLERNEFDTIYHEHLSYIGVGSLVALFR
RHGLRVVDVERLAVHGGSILVFVGLDEGTRATAPVVEELIALEKERGLYEDATYERFARH
VAEITAELTSMVRSLRAEGKRIAGYGAPAKGNTLLNVCGLTADDLEFCCDTTEFKQGLVL
PGTHIPVRSPEYAKTQAIDYYLLLAWNYGEEILAKEGPFLADGGRFILPNPRPSIVPPGE
Reference
  Authors
Gonzalez A, Remsing LL, Lombo F, Fernandez MJ, Prado L, Brana AF, Kunzel E, Rohr J, Mendez C, Salas JA
  Title
The mtmVUC genes of the mithramycin gene cluster in Streptomyces argillaceus are involved in the biosynthesis of the sugar moieties.
  Journal
Mol Gen Genet 264:827-35 (2001)
DOI:10.1007/s004380000372

DBGET integrated database retrieval system