KEGG   Addendum: CAK95245
Entry
CAK95245          CDS       T10000                                 

Gene name
ADC-16
Definition
(KEGG) beta-lactamase class C ADC-16
  KO
K20319  beta-lactamase class C ADC [EC:3.5.2.6]
Taxonomy
TAX:48296
  Lineage
Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Moraxellaceae; Acinetobacter; Acinetobacter calcoaceticus/baumannii complex
Organism
ag  Addendum (Acinetobacter pittii)
SSDB
Motif
Pfam: Beta-lactamase NdhS
Other DBs
NCBI-ProteinID: CAK95245
GB: AM283525
UniProt: Q0VTR8
AA seq 383 aa
MRFKKISCLLLPPLFIFSSSIYAGNTPKEQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNN
KKYEMYYGLQSVQDKKAVNSNTIFELGSVSKLFTATAGGYAKTKGTISFNDTPGKYWKEL
KNTPIDQVNLLQLATYTSGNLALQFPDEVKTDQQVLTFFKEWKPKNPIGEYRQYSNPSIG
LFGKVVALSMNKPFDQVLEKTIFPDLGLKHSYVNVPKTQMQNYAFGYNQENQPIRVNPGP
LDAPAYGVKSTLPDMLSFINANLNPQKYPANIQRAINETHQGFYQVGTMYQALGWEEFSY
PALLQTLLDSNSEQIVMKPNKVTAISKEPSVKMFHKTGSTNGFGTYVVFIPKENIGLVML
TNKRIPNEERIKAAYAVLNAIKK
Reference
  Authors
Beceiro A, Perez A, Fernandez-Cuenca F, Martinez-Martinez L, Pascual A, Vila J, Rodriguez-Bano J, Cisneros JM, Pachon J, Bou G
  Title
Genetic variability among ampC genes from acinetobacter genomic species 3.
  Journal
Antimicrob Agents Chemother 53:1177-84 (2009)
DOI:10.1128/AAC.00485-08

DBGET integrated database retrieval system