KEGG   Addendum: CAP12607
Entry
CAP12607          CDS       T10000                                 

Gene name
elmGT
Definition
(KEGG) 8-demethyltetracenomycin C L-rhamnosyltransferase (EC:2.4.1.331)
  KO
K19566  8-demethyltetracenomycin C L-rhamnosyltransferase [EC:2.4.1.331]
Taxonomy
TAX:47716
  Lineage
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces
Organism
ag  Addendum (Streptomyces olivaceus)
Module
47716_M00784  Elloramycin biosynthesis, 8-demethyltetracenomycin C => elloramycin A
SSDB
Motif
Pfam: UDPGT DUF1205 Glyco_tran_28_C Glyco_transf_4
Other DBs
NCBI-ProteinID: CAP12607
GB: AM900040
UniProt: Q9F2F9
AA seq 382 aa
MRVLAVATPALGHLFPAVPLLWALRARGDEVLVVTGGDALRVAEAGLPVVDALPGETLTT
LFGAYQETDPAFFVALRRSPMTTLRDLAPVLAYLAGRLLEPARRAAERWRPDAILATHGQ
AAGAVVAAEHGIPLVEHGFGFVRSDGAQEAVRQLLAERLGPAGSEPPPERYFLDIAVPSM
TSAIEGMSLRAVPYNGGAVLPLSGASVGGRPPRPRVLVTAGTQLLHTHGAGALAWLPEVA
AGHEAEFLLAAGGADLRDLGRLPPHVRVLDWTPLATVLPTCSAVVHHGGSGTTLAALAAG
VPQLVSPALADNHINARAVADRGAGLETAVPDATTLTALLREPAFAKAAREVADELRSLP
APADVAARLHTAFGLPTTQGDA
Comment
Identical to: CAC16413
Reference
  Authors
Blanco G, Patallo EP, Brana AF, Trefzer A, Bechthold A, Rohr J, Mendez C, Salas JA
  Title
Identification of a sugar flexible glycosyltransferase from Streptomyces olivaceus, the producer of the antitumor polyketide elloramycin.
  Journal
Chem Biol 8:253-63 (2001)
DOI:10.1016/S1074-5521(01)00010-2
Reference
  Authors
Ramos A, Lombo F, Brana AF, Rohr J, Mendez C, Salas JA
  Title
Biosynthesis of elloramycin in Streptomyces olivaceus requires glycosylation by enzymes encoded outside the aglycon cluster.
  Journal
Microbiology 154:781-8 (2008)
DOI:10.1099/mic.0.2007/014035-0

DBGET integrated database retrieval system