KEGG   Addendum: CCD27744
Entry
CCD27744          CDS       T10000                                 

Gene name
auaG
Definition
(KEGG) aurachin C monooxygenase/isomerase (EC:1.14.13.222)
  KO
K21272  aurachin C monooxygenase/isomerase [EC:1.14.13.222]
Taxonomy
TAX:41
  Lineage
Bacteria; Proteobacteria; Deltaproteobacteria; Myxococcales; Cystobacterineae; Archangiaceae; Stigmatella
Organism
ag  Addendum (Stigmatella aurantiaca)
Module
41_M00848  Aurachin biosynthesis, anthranilate => aurachin A
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase Pyr_redox_2 Pyr_redox NAD_binding_8
Other DBs
NCBI-ProteinID: CCD27744
GB: HE580420
UniProt: H1ZZA4
AA seq 383 aa
MKTGLTVLIAGGGIGGLTLGVALRRAGIAFKIFERAPALLRVGAGISMQSNAMLAFRTLG
VDTAVAAAGQEIQGGAILNPRGEEISSMPVSKASAEVGAPMITIHRGRLQDVLHQIVGDD
NLVLGAKVEGFRDGPDGLFVRLADGREFQGDLLVGADGLRSAVRAQLLKEPSPRYSGYTS
WRGVCDVSEGVRRDYTSESWGPGMRFGVVPIGEGQTYWFATATAPEGGVDHPDARTELLQ
RFSGWHAPIPQLIENTPSSAIMRTDIHDRVPIRQWVQGRAVLLGDAAHPMTPNMGQGGCQ
AVEDAVVLARCLSLEAELPAALARYQAVRVERANDFVAGSYRIGQIGQWENAFACWVREK
LMRMMSSDRVDARTRRNLQFTPL
Reference
  Authors
Pistorius D, Li Y, Sandmann A, Muller R
  Title
Completing the puzzle of aurachin biosynthesis in Stigmatella aurantiaca Sg a15.
  Journal
Mol Biosyst 7:3308-15 (2011)
DOI:10.1039/c1mb05328k
Reference
  Authors
Katsuyama Y, Harmrolfs K, Pistorius D, Li Y, Muller R
  Title
A semipinacol rearrangement directed by an enzymatic system featuring dual-function FAD-dependent monooxygenase.
  Journal
Angew Chem Int Ed Engl 51:9437-40 (2012)
DOI:10.1002/anie.201204138

DBGET integrated database retrieval system