KEGG   Addendum: NP_803144
Entry
NP_803144         CDS       T10000                                 

Gene name
NS3
Definition
(KEGG) Hepatitis C virus NS3 protease
  KO
K22273  HCV serine protease NS3 [EC:3.4.21.98]
Taxonomy
TAX:11103
  Lineage
Viruses; Riboviria; Orthornavirae; Kitrinoviricota; Flasuviricetes; Amarillovirales; Flaviviridae; Hepacivirus
Organism
ag  Addendum (Hepacivirus C)
SSDB
Motif
Pfam: Peptidase_S29 Flavi_DEAD Helicase_C AAA_30 ResIII
Other DBs
NCBI-ProteinID: NP_803144
GB: NC_004102
Structure
PDB: 

AA seq 631 aa
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAG
TRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRG
DSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMR
SPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGA
YMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSI
LGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIK
GGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTGFTG
DFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGE
RPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLT
HIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLY
RLGAVQNEVTLTHPITKYIMTCMSADLEVVT
Comment
Polyprotein 1027-1657
Reference
PMID:9228008
  Authors
Kolykhalov AA, Agapov EV, Blight KJ, Mihalik K, Feinstone SM, Rice CM
  Title
Transmission of hepatitis C by intrahepatic inoculation with transcribed RNA.
  Journal
Science 277:570-4 (1997)
DOI:10.1126/science.277.5325.570

DBGET integrated database retrieval system