KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000400Help
Entry
AgaP_AGAP000400   CDS       T01036                                 

Definition
(RefSeq) AGAP000400-PA
  KO
K17498  transcription factor SPN1
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aga03021]
    AgaP_AGAP000400
Transcription machinery [BR:aga03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     AgaP_AGAP000400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 1271845
NCBI-ProteinID: XP_310699
VectorBase: AGAP000400
UniProt: Q7QFC0
Position
X
AA seq 640 aa AA seqDB search
MEANGEPVAVVPQPPNGDEPKTTISELEPTVEPKLLPDETAQTVGDAGDGKEQQQQQQQQ
DDAVVPSAPVDSAKEAGATVEETAASGGLEGKMHSPPRNRSGSRDSHTSQPDRRRRRSGS
EVSEAGSRKSRSRSRQSRRSRNRRGSHSASVSRSRSRSGSRLSSQRRVRTPSRSRSRSGS
GSRSRSRSRSRSQSRSRSRSGSGSRSRSRSGSGSRSRSRSGSGSRSRSRSRSRSRARSRS
GSASSSRSRSSKSKSRSRSSPSMAAGEEKAGPSSSGKHSKPAKRIIDSDDEEGEEGDPAA
GNGEGKEREEGEEDEPGSGDEGKAKGKQTLIDSDDDGIKDDGSDRGQFMSDFDIMMAKKK
EEKSRRRKRNDIDLINDNDDQIAQLLQQMRQAAEHDRQLNVEGKPATKKIAMLKHAMSQL
IKKDLQLAFLEHNVLNVLTDWIAPLPNKALPCLQIRESILKLLSDFPTIDRSYLRQSGIG
KAVMYLYKHPNETKVNRDRAGRLIADWCRPIFNLSTDFKAMTREERQQRDLQQMPRKRKP
SPDSAASTSKSQKGLPFTEADKGTLRPGDKGWIQRARVPMPSDKEYIVRPKSKIDVDMSS
IAKKKLNRYEKHLKKFIDQKRLNSTRRAVDISIEGRKMAL
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaacggcgagccggtcgccgtggttccgcaaccacccaacggggatgaaccg
aaaacgaccatcagcgagctggaacctactgtcgagccaaagctactaccagacgaaaca
gcccagaccgtgggcgatgccggcgatggaaaggaacagcagcagcagcagcagcagcag
gacgatgccgttgtgccttcggcacccgtagatagcgcaaaggaagcaggtgcgacggtg
gaggaaacggcagcatcggggggactggaggggaaaatgcactcgccccctcgcaaccgg
agcggttcgcgcgacagccacacatcacagccggaccgtcgacggcgccggagcggctcg
gaggtcagcgaggccggttcgcgcaagagccgaagccgatcgcgccagagccggcgatcg
cgcaaccggcgcggcagccactcggccagcgtcagccgcagccgcagccgctcgggaagt
cgcctatcgtcgcagcggcgcgtccgcacaccatcccggtcgcggtcgcgctccgggtcc
ggctcgcggtcccgctcacggtcccggtcccgttcgcaatctcgctcccgctcacgctcc
ggctccggttcccgctcacgctcacggtccggttccgggtcgcgttcccggtcccgctcc
ggctcgggctcacggtcccgttcgcggtcgcgatcccgctcccgggcccgttcccgctcc
ggttcggcctcgagctcgcggtcccgctcgtccaagtcgaaatcgcgcagccgcagcagc
ccgtcgatggcggccggcgaggagaaggccggaccgagcagctcgggcaagcacagcaag
ccggccaagcgcatcatcgattcggacgacgaggagggcgaggagggcgacccggctgcc
ggcaacggcgagggcaaggagcgcgaggagggcgaggaggacgagcccggttccggcgac
gagggcaaagcgaagggcaagcagacgctgatcgattccgacgacgacggcatcaaggac
gatgggtccgacaggggccagttcatgtcagactttgacatcatgatggccaagaagaag
gaggaaaagtcgcgccgccgcaagcggaacgacatcgatctgatcaacgacaacgacgac
cagatcgcgcagctgctgcagcagatgcgccaggcggccgagcacgaccggcagctgaac
gtggagggcaagccggcaacgaagaagatcgccatgctgaagcacgcgatgtcgcagctg
atcaagaaggatctgcagctcgcgttcctcgagcacaacgtgctgaacgtgctcaccgac
tggatagcgccgctgccgaacaaggcgctgccgtgtctgcagatacgcgaaagcatcctg
aagctgctgtcggacttccctaccatcgaccggtcctacctgcggcagtcgggcatcggc
aaggcggtgatgtatctgtacaagcacccgaacgaaacgaaggtgaaccgtgaccgggca
ggccggctgatagcggactggtgccggccaatcttcaacctcagcaccgacttcaaggcg
atgacgcgcgaggagcgccagcagcgcgacctgcagcagatgccgcgcaagcgcaaaccg
tccccggactcggcggcctccaccagcaagagccagaaggggctgcccttcaccgaggcg
gacaaaggaacgttgcgaccgggcgacaagggctggatacagcgggcgcgcgtcccgatg
ccatccgacaaggagtacatcgtgcggccgaaatccaaaattgatgtagatatgagcagt
attgcgaagaagaagctaaaccgctacgagaagcatctgaagaagtttatcgaccagaag
agactgaactcgacgcgccgcgcggtcgacatttccatcgagggacgtaaaatggcgctc
tag

DBGET integrated database retrieval system