KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000440
Entry
AgaP_AGAP000440   CDS       T01036                                 

Definition
(RefSeq) AGAP000440-PA
  KO
K05677  ATP-binding cassette, subfamily D (ALD), member 3
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga02010  ABC transporters
aga04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:aga00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AgaP_AGAP000440
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AgaP_AGAP000440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aga02000]
    AgaP_AGAP000440
Transporters [BR:aga02000]
 ABC transporters, eukaryotic type
  ABCD (ALD) subfamily
   ABCD3 subgroup
    AgaP_AGAP000440
SSDB
Motif
Pfam: ABC_membrane_2 ABC_tran SMC_N AAA_23 AAA_29 Rad17 AAA_21 AAA_15 AAA_16
Other DBs
NCBI-GeneID: 1271802
NCBI-ProteinID: XP_310656
VectorBase: AGAP000440
UniProt: Q7QFE4
Position
X
AA seq 659 aa
MAPNLSKLLGNQNAVVGVAGCTAAACIILYGKQIHKNRKQRPEDEIQYLISDKKEKRSPK
AHVNAVFFNQLRTLLGIIIPKKWSVENGLLVVIALSLIARSVSDIWMIQNATAIESTIIT
MNKKQFRTALVKYLSALPAIAVVNNVLKWSIGELKLRFRTNLSQYLYNEYLKGFTYYKMS
NLDNRIANADQLLTTDIDKFCESVTDLYSNICKPLLDIVIYVYRLTTNLGGTTPGILLLY
LFFSGVFLTNLRKPTGRLTVLEQKLEGEFRYVNSRLITNSEEIAFYKGNNREKLTILASF
NKLVGHLRKFLEFRVGMGIVDNMVAKYIATVVGFYAVSLPFFEKDHPLLTGSQQSERLSR
YYTFGRMLVKLAEAIGRLVLAGREMSRLAGFTARMTELTVVLKDLNSGRYERTMVNNSAI
ADAGDIGPGRGLLKFQDNLIKFEHVPLVTPNGDVLVKDLTFEVKSGMNVLVCGPNGCGKS
SLFRILGELWPTWGGKVTKPPAGKLFYIPQRPYMTLGSLRDQIIYPHTHQEMKRRGKTDA
DLLKYLDLVQLTYLQVREKGLDAIEDWIDVLSGGEKQRIAMARLFYHNPQFAILDECTSA
VSVDVEGSMYQYCRAVGITLFTVSHRKSLWTHHDYYLKFDGHGAYEFGPIEGTQDQFGS
NT seq 1980 nt   +upstreamnt  +downstreamnt
atggcaccgaacctgagcaagctgctcggcaaccagaatgccgtggtcggtgtggccgga
tgtacggcggccgcctgcatcatactgtacggcaagcagatccacaagaatcgcaaacag
cgaccggaggacgagatacaatatttaatcagcgacaagaaggaaaagcgcagcccgaag
gctcacgtcaatgccgttttcttcaaccagctgcgcacgctgttaggcatcattataccg
aagaaatggagcgtcgagaacggtttgctggtcgtgattgcactgtcgctgattgcccgc
tcggtcagcgacatctggatgatacagaatgcgaccgcgatcgagagcacaatcatcacg
atgaacaagaagcagttccggaccgcgctggtcaagtacctgtccgcgctgcccgcgatt
gccgtggttaacaacgtgctgaaatggagcataggcgagctgaagctacgcttccgcacc
aacctgtcgcaatacctatacaacgagtacctgaaaggcttcacctactacaaaatgtcc
aacctggacaaccggatagcgaacgcggaccagctgctgacgaccgacattgacaagttc
tgcgagagcgttaccgacctgtactcgaacatctgcaagccgctgctcgacatcgtcatc
tacgtgtaccggctgacgaccaacctgggcggcacgacgcccggtatcctgctgctgtat
ctgttcttctccggcgtgtttctcaccaacctgcgcaagccgaccggccggctgaccgtg
ctggagcagaagctggagggcgagttccggtacgtgaacagtcggctgatcaccaactcg
gaggagatcgcgttctacaagggcaacaaccgggagaagctgacgatactggccagcttc
aacaagctcgtcggccacctgcgcaagttcctcgagttccgcgtcggcatgggcatcgtg
gacaacatggtggcgaaatacattgcaacggtcgttggattctacgccgtgtcgctgccg
ttcttcgagaaggatcatccgctgctgaccggcagccagcagagcgaacggttgagccgc
tactacacgttcggccgcatgctggtgaagctggcggaggcgatcgggcggctggtgctg
gccggccgggagatgtcccggctggccgggttcaccgcccgcatgaccgagctgacggtc
gtgctgaaggacctcaactcgggccggtacgagcgcacgatggtgaacaactcggcgatc
gcggacgcgggcgacatcggcccgggccggggcctgctcaagttccaggacaatctgatc
aagttcgagcacgtgccgctggtgacgccgaacggcgacgtgctggtgaaggacctcacg
ttcgaggtcaagtccggcatgaacgtgctcgtgtgcggcccgaacgggtgcggcaagagc
agcctgttccgcatcctcggcgagctgtggccgacgtggggcggcaaggtgacgaaaccg
cccgccggcaagctgttctacatcccccagcgcccgtacatgacgctcggctcgctgcgc
gatcagattatctatccgcacacgcaccaggagatgaagcggcgcggcaaaaccgacgcg
gacctgctcaagtacctcgacctggtgcagctcacctacctgcaggtgcgggagaagggc
ctggacgcgatcgaggactggatcgacgtgctgtccggcggcgagaagcagcggatcgcg
atggcccgcctgttctaccacaatccgcagttcgcgatcctggacgagtgcacgtcggcg
gtgtcggtggacgtcgagggcagcatgtaccagtactgccgggcggtcggcatcacgctc
ttcaccgtgtcgcaccggaagtcgctctggacgcaccacgactactacctcaagttcgac
ggccacggggcgtacgagttcgggccgatcgagggcacgcaggaccagttcggctcgtaa

DBGET integrated database retrieval system