KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP000823
Entry
AgaP_AGAP000823   CDS       T01036                                 
Name
(RefSeq) AGAP000823-PA
  KO
K06508  CD81 antigen
Organism
aga  Anopheles gambiae (malaria mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aga04147]
    AgaP_AGAP000823
   04090 CD molecules [BR:aga04090]
    AgaP_AGAP000823
Exosome [BR:aga04147]
 Exosomal proteins
  Proteins found in most exosomes
   AgaP_AGAP000823
CD molecules [BR:aga04090]
 Proteins
  AgaP_AGAP000823
SSDB
Motif
Pfam: Tetraspanin DUF4870 YfhO Tweety
Other DBs
NCBI-GeneID: 1277333
NCBI-ProteinID: XP_316787
VectorBase: AGAP000823
UniProt: Q7Q4Y1
Position
X:15327411..15333680
AA seq 268 aa
MAIKGCCSVVKYLVVLVNLLFWVVGFLIVSLAIWMLSDPTFLISMTQNETNYTIGLYIFL
VVGGLMLVVAFLGCCGAFKESQWMLTSFFCCLLMVLVAELAAGAWAFQNSDKLDNVVRSA
VKEAVQTQYGVIPMRTATLDAIQKHYKCCGAEGPNDWQSSAFNNAERPTPSIEISNQPTI
YKVPETCCVSNITPEQCEKATQMEFLASTKKQPHLFADGCMEKLVQAVQDNIKLICYVGA
AIVGIELLTLILSLLLCCAIRRNDNYKH
NT seq 807 nt   +upstreamnt  +downstreamnt
atggcaatcaagggctgctgctccgtggtcaagtacctggtggtgctggtaaaccttctg
ttctgggtcgtcggatttttaatcgtgtcgctcgccatctggatgctgtccgatccgacc
ttcctgatatcgatgacccagaacgagacgaactacacgatcgggctgtacatcttcctg
gtggtcggtgggctgatgctggtcgtcgccttcctcggctgctgcggtgcatttaaggaa
tcgcaatggatgctcacttcgttcttctgctgcctgctgatggtgctcgtagccgagctg
gccgccggtgcctgggcgttccaaaactcggacaagctggacaacgtggtccggtcggcg
gtgaaggaagcggtccagacgcagtacggcgtcattcccatgcgcaccgccacgcttgat
gcgatccagaagcattacaagtgctgcggggccgagggaccaaacgactggcaatcaagc
gcgttcaacaacgcggagcggccgacaccgagcatcgagatctccaatcaaccaaccatc
tacaaggtgccggaaacgtgctgcgtgtccaacattacgcccgagcagtgcgaaaaggcg
acgcagatggagttcctggcgtcgaccaagaagcagccgcatctgttcgccgatggttgc
atggaaaagctggtgcaggcggtacaggataacatcaagctgatctgttacgtcggtgcg
gcgatcgtcggcatcgagttgctgacgttgatactttccctgctgctgtgttgcgcgatc
cgccgaaacgataactacaagcactaa

DBGET integrated database retrieval system