KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000829
Entry
AgaP_AGAP000829   CDS       T01036                                 

Definition
(RefSeq) AGAP000829-PA
  KO
K08582  calpain-15 [EC:3.4.22.-]
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aga01002]
    AgaP_AGAP000829
Enzymes [BR:aga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     AgaP_AGAP000829
Peptidases and inhibitors [BR:aga01002]
 Cysteine peptidases
  Family C2: calpain family
   AgaP_AGAP000829
SSDB
Motif
Pfam: Peptidase_C2 zf-RanBP zf-Sec23_Sec24 EIF4E-T TFIIA
Other DBs
NCBI-GeneID: 4576096
NCBI-ProteinID: XP_001231066
VectorBase: AGAP000829
Position
X
AA seq 880 aa
MDEYSTHQNSTILELDNIPAIVRVPIASFEQDLDDEWCTKCKQPSKGTDEKEWSCRKCTL
VNSSAALACVACGGSKLRSICNVEEMTLKKGEFWACHKCTLKNSIVQPDCSACKTARPAG
KGVLVNESLATNRLILGQCDEQSNSSRASSAAVVPPIDSGAIPKQLLQQQLQPLHQLQHQ
QQQQQQQQQPLAHPPAPVPAHQPSGGAAKALVPAMQVTIPKRTWQCPACTYENSLACVVC
DICSSHRHIDTGCLVWQQQHQQLQQSNRLEENQRQLDDLEALNRWKSIIEYCVENGQAFV
DDSFPPAMKSLYYQPSSNIECNPVAQWRRPNEILCEGGNQSTAPQWAVFRTPLPSDICQG
VLGNCWLLSALAVLAEREDLVKEVLLTKEICPQGAYQVKLCKDGRWTTVLVDDLLPCDKR
GHLVYSQAKRKQLWVPLIEKAVAKIHGCYEALVSGRAIEGLATLTGAPCESIPLQASSLP
LPSEDDLDRDLIWAQLLSSRLVKFLMGASCGGGNMKVDEDEYQRKGLRPRHAYSVLDVRD
IKGHRLLKLRNPWGHFSWQGDWSDDSELWTDELRDSLMPHGGSEGVFWISFEDVLRYFDC
IDICKVRSEWNEVRLFGTLQPLRALSCVLITVLEPTEAEFTLFQEGQRNSEKSQRSQLDL
CVVLFRTRNPANPEVGRLVEHSKRQVRGFVGCHKMLETDLYMLVCLAFNHWHTGIDDFMH
YPQCVLAIHSSKRLLVEQITPPPFLLADAIINLTLAKGQRHEGREGMTAYYLTKGWAGLV
VMVENRHENKWIHVKCDCQESYNVVSTRGELKTVDSVPPLQRQVIIVLTQLEGSGGFSIA
HRLTHRLANSGGLHDWGPPSSTHYPPIENVSELHSPRMIT
NT seq 2643 nt   +upstreamnt  +downstreamnt
atggatgagtacagcacgcatcagaattccacgatactagagctagataatattccagcg
atcgtgcgggtgccgatcgcgagcttcgagcaggatctggacgacgagtggtgcacaaag
tgtaagcagccatcgaaagggaccgatgaaaaggaatggtcctgccggaagtgtacgctc
gtcaattcgagcgccgcgctcgcgtgcgttgcttgcggcggttcgaagctgcgcagcatc
tgcaacgtggaggagatgacgctgaagaagggcgaattttgggcgtgccacaagtgcacg
ctcaagaactcgatcgtccagccggactgcagcgcctgcaagacggcgcgcccggccggc
aagggtgtgctggtgaacgagtcgctcgccaccaaccgcctgatactgggccagtgcgac
gagcagtcgaacagtagcagagcgtcgagcgcggctgtcgtcccgccgatcgattccggt
gccattccaaagcagctgctgcagcagcagctacagccgctacaccagctacagcaccag
cagcagcagcagcaacagcagcagcaaccgctggcccatccaccggccccagtgccggcg
caccagccgtccggcggtgcagcgaaagcgcttgtgccggcgatgcaggtcacgataccg
aagcgcacctggcagtgtccggcgtgcacgtacgaaaactcgctcgcgtgcgtggtgtgc
gacatttgctcaagccaccggcacatcgacaccggctgcctggtgtggcagcagcagcac
cagcagctgcagcagagcaaccggctcgaggagaaccagcgccagctggacgatctcgag
gcgctgaaccgctggaaaagcatcatcgagtactgcgtggagaacgggcaggcgttcgtg
gacgactcgttcccgccggcgatgaaaagcctctactaccagccgtcgtccaacatcgag
tgcaacccggtcgcccagtggcgccggccgaacgagatcctgtgcgagggcggcaaccag
tcgaccgcaccgcagtgggccgtcttccgcacgccgctaccgtcggacatctgccagggc
gtgctcggcaactgctggctgctgagcgcgctggccgtgctggcggagcgggaggacttg
gtgaaggaggtgctgctgacgaaggagatctgcccgcagggcgcgtaccaggtgaagctg
tgtaaggacggccgctggacgacggtgctggtggacgatctgctgccgtgcgacaagcgc
ggtcacctcgtctactcccaggcgaagcggaaacagctctgggtgccgctgatcgagaag
gcggtcgcgaagatacacggctgctacgaggcgctcgtgtcgggccgggcgatcgagggc
ctcgccacgctgaccggcgcaccgtgcgaaagcattccactgcaggccagctcattgcca
ctgccgagcgaggacgatctcgaccgcgacctgatctgggcccagctgctcagctcccgg
ctggtaaagttcctgatgggggcgagctgcggcggcggcaacatgaaggtggacgaggac
gagtaccagcggaagggactgcggccgcgccacgcttactccgtgctggacgtgcgggac
atcaaggggcaccggctgctcaagctgcgcaacccgtggggacacttttcctggcaaggc
gactggtcggatgattccgagctgtggacggacgagctgcgcgacagcttgatgccgcat
ggcggttcggagggcgtgttttggatatcgtttgaagatgtactgagatactttgactgc
atcgacatctgcaaggtgcgctcggaatggaacgaggtgcgcctgtttggcacgctgcaa
ccactccgcgcgttgtcctgcgtgctcataaccgtgctcgaaccgaccgaggccgagttc
accctgttccaggaggggcaacgaaattcggaaaaatcgcaacgctcccagctagacctg
tgtgtggtgctgttccggacgcgaaaccccgccaaccctgaggtgggccgactggtcgag
cacagcaagcggcaggttcgtggattcgtcggctgccacaagatgctggaaacggacctg
tacatgctggtatgtctcgccttcaaccactggcacacgggaattgacgacttcatgcac
tacccgcagtgcgtgctggcgatccacagctccaagcggctgctggtcgagcagatcacg
ccgcccccattcctgctggccgacgccatcatcaacctgacgctggccaaggggcagcgg
cacgagggccgggaaggcatgaccgcgtactacctgacgaagggatgggcgggactggtc
gtgatggtggaaaatcggcacgaaaacaagtggatacacgtcaagtgtgattgccaggaa
agctacaacgtcgtctcgacgcgaggcgagctgaagacggtcgattccgttccaccgctg
cagcgacaggtgatcatcgtgctgacgcagctggaaggcagcggcggcttcagcatagcc
catcgcctaacgcatcggctggccaactcgggcggcctgcacgactggggaccgccctcc
tccacccactatccgccgatcgagaacgtgtccgagctgcattcgccccgcatgataacc
tag

DBGET integrated database retrieval system