KEGG   Anopheles gambiae (mosquito): AgaP_AGAP000881Help
Entry
AgaP_AGAP000881   CDS       T01036                                 

Definition
(RefSeq) AGAP000881-PA
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00010  Glycolysis / Gluconeogenesis
aga00053  Ascorbate and aldarate metabolism
aga00071  Fatty acid degradation
aga00260  Glycine, serine and threonine metabolism
aga00280  Valine, leucine and isoleucine degradation
aga00310  Lysine degradation
aga00330  Arginine and proline metabolism
aga00340  Histidine metabolism
aga00380  Tryptophan metabolism
aga00410  beta-Alanine metabolism
aga00561  Glycerolipid metabolism
aga00620  Pyruvate metabolism
aga01100  Metabolic pathways
Module
aga_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AgaP_AGAP000881
   00053 Ascorbate and aldarate metabolism
    AgaP_AGAP000881
   00620 Pyruvate metabolism
    AgaP_AGAP000881
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AgaP_AGAP000881
   00561 Glycerolipid metabolism
    AgaP_AGAP000881
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AgaP_AGAP000881
   00280 Valine, leucine and isoleucine degradation
    AgaP_AGAP000881
   00310 Lysine degradation
    AgaP_AGAP000881
   00330 Arginine and proline metabolism
    AgaP_AGAP000881
   00340 Histidine metabolism
    AgaP_AGAP000881
   00380 Tryptophan metabolism
    AgaP_AGAP000881
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AgaP_AGAP000881
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AgaP_AGAP000881
    1.2.1.8  betaine-aldehyde dehydrogenase
     AgaP_AGAP000881
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     AgaP_AGAP000881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 1277397
NCBI-ProteinID: XP_316857
VectorBase: AGAP000881
UniProt: Q7Q4T4
Position
X
AA seq 540 aa AA seqDB search
MIGTLLQRGPKLNNVICKILGARSMSGMTKYLVEEDNFAFLRDLGLQRVNNGVYNGEWVA
GTAGKVQSIDPASGRVIAEVATGSEQDLERCLTAGVAAYQEWKKIPAPLRGDVIRQIGDE
LRKYREPLGKLVALEMGKILPEGVGEVQEFVDICDYAVGLSRMFGGAIFPSERPQHTILE
KWNPLGLVGVISAFNFPCAVFGWNAAIALTVGNTVLWKGAPSTSLVSVATTKIVTDVIKR
NKLPPIVTLCQGGEDVGKRMVSDERIRLMSFTGSTAVGRTVGIEMQRRFGRCLLELGGNN
ALIINEDAPQEMALDAAFFGCIGTAGQRCTTTRRLIIHAKLYDSFIAKLVKRYASLLKRV
GHPLDSATLYGPVHNQQAVDNYLQTVQEAVALGGKVECGGKVIDRAGFFVEPTIISNLPH
DAPVVKRETFAPIVYVFKASNLQEAISWNNEVDQGLSSSLFTNNIQSAFEWLGESGSDCG
IVNINTSPSGAEIGGAFGGEKHTGGGRESGSDAWKQYARRSTITVNHSTDLPLAQGIVFE
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgataggaacactgctgcaaagggggccaaagttgaacaacgtcatttgcaagatcctc
ggcgcacgcagcatgagcggcatgacgaagtatttagtcgaagaggacaattttgccttc
ctgcgcgatctcggcctgcagcgcgtgaacaatggtgtgtacaacggcgaatgggtggcc
ggcacggccggcaaggtgcagtcgatcgatcccgcatccggccgggtaatagcggaggtt
gctaccggctccgaacaggatctggaacgctgcctgacggccggtgtggccgcctaccag
gagtggaagaaaatcccggccccactgcgcggtgacgtcatacgccagattggcgacgag
ctgcgcaagtaccgggagccgctcggcaagctggtggcactggagatgggcaaaatcctg
cccgagggggtcggcgaggtgcaggagtttgtggacatctgcgactacgcggtcgggctg
tcgcgcatgttcggcggcgccatctttccctccgagcggccgcagcacacgatcctggag
aagtggaacccgctcgggctggtcggcgtcatatcggcgttcaactttccctgcgccgtc
tttggctggaatgcggcgatcgcactgacggttggcaacaccgtgctgtggaagggcgcc
cccagcacgtcgcttgtgagcgtggcgaccactaagatagtgaccgacgtgatcaagcgc
aacaagctgcccccgattgtgacgctctgccagggcggcgaggacgtcggtaagcggatg
gtgagcgacgagcgcatcaggctgatgtccttcaccggcagcacggccgtcggccgcacg
gtgggcatcgagatgcagcgccggttcgggcgctgcctgctggagctcggcggcaacaat
gcgctcatcatcaacgaggatgcgccgcaggagatggcgctggatgcggcgttcttcggc
tgcatcggcacggccggccagcgatgcaccacgaccaggcggctgatcatacacgcaaag
ctgtacgacagcttcatcgcgaagctggtcaagcggtacgccagcctgctgaagcgcgtc
ggccatccgctggattcggccacgctgtacgggccagtgcacaaccagcaggcggtggac
aattacttgcagacggtgcaggaagcggtcgcgctcggtggcaaggtcgagtgcggtggc
aaggtgatcgatcgggccgggttcttcgtcgagccgaccatcatctccaacctgccgcac
gatgcgccggtcgtgaagcgggaaacatttgcgcccatcgtgtacgtgttcaaggcgagc
aacttgcaggaggcgatcagctggaacaacgaagtcgaccaagggctgtcgtcgtccctt
ttcaccaacaacatccagtcggcgtttgagtggctgggagagagtggttccgactgcgga
atcgtaaatatcaacacttcgccctcgggagcggaaattggaggcgcgttcggtggcgag
aaacataccggcggtggccgtgaatcgggatccgacgcctggaagcagtacgcgcgacga
tcaactatcaccgtcaatcattcaaccgatttgccactggcacagggaattgtatttgaa
taa

DBGET integrated database retrieval system