KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001458Help
Entry
AgaP_AGAP001458   CDS       T01036                                 

Definition
(RefSeq) AGAP001458-PA
  KO
K11416  mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     AgaP_AGAP001458
Chromosome and associated proteins [BR:aga03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     AgaP_AGAP001458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2
Motif
Other DBs
NCBI-GeneID: 1281717
NCBI-ProteinID: XP_321669
VectorBase: AGAP001458
UniProt: Q7PXL0
Position
2R
AA seq 354 aa AA seqDB search
MSCNYAEGLSKYENKGVLGVAEIFDTPELVEEKCEQLVKMMLASSHTVVHTGAGISTSAG
IPDFRGPNGVWTLEEKGEKPAVNISFDDAVPTRTHMALKSLVASGHVQYIVSQNIDGLHL
RSGLAREHLSELHGNMFLEVCTKCRRQYVRSSPAPTVGKKETGNICPGTSAERACRRGKL
IDNILDWEHDLPENDLQLAFMHSAMADLNICLGTTLQIVPSGDLPLKNLKHGGRLVICNL
QPTKHDKKADLKISTYVDAVLERVAKRLGVEIPEYRREEDPTKRDTYSVQWNIDGKMVKS
LEKRYDSTIKEKNQLKKRCSTSSIDQDREDLKRNNKKLKQEQPSNATNEGDLNS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgcaattacgctgaagggctgtcaaaatatgaaaacaagggtgtgcttggtgtg
gcagagatctttgatactcccgaactggtggaggaaaaatgcgagcagctggtgaaaatg
atgcttgcctcgagccataccgtcgtgcacacgggtgctgggattagcacgagcgcgggc
ataccggatttccgcggccccaacggtgtctggacgctggaggagaaaggggaaaaaccc
gctgttaatatttcgttcgatgatgccgtgcctacccgcacgcacatggctctgaagtcg
ctcgtagccagtggtcacgtgcagtacatcgtcagccagaatatcgacggtttgcatctg
cggtcagggcttgcgagggaacacctgtccgaactgcacggcaatatgtttttggaggtg
tgcaccaaatgtcgtcgtcagtacgtacgaagcagtccagcgccaacagtgggcaaaaag
gagactggaaacatttgtcccggcacgagtgcggagcgcgcctgtcgtcgaggcaagctg
atcgacaacatcctagactgggagcatgatctacctgaaaatgatctccaactggcattt
atgcattccgcgatggcagatcttaacatctgccttgggacgacattgcaaatcgtgccg
agcggtgatctaccgctaaaaaatctcaaacacggaggacgactcgtcatctgcaatctg
cagccgaccaagcatgacaaaaaggcagatttgaaaatttcaacctacgttgatgcggtg
cttgaacgagtggccaaacgattaggtgtagaaatacctgagtatcggagggaagaagat
ccaaccaaacgcgatacgtacagtgtgcagtggaacatcgatggaaaaatggtgaaatca
ttagaaaaacggtacgatagtacgataaaagagaaaaaccagctaaagaagcgatgttcc
acatccagcatcgatcaggaccgcgaggatttgaaaagaaacaacaagaaactaaaacaa
gaacaacctagcaatgcaacaaatgaaggagatctaaatagttga

DBGET integrated database retrieval system