KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001630Help
Entry
AgaP_AGAP001630   CDS       T01036                                 

Definition
(RefSeq) AGAP001630-PA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00010  Glycolysis / Gluconeogenesis
aga00051  Fructose and mannose metabolism
aga00562  Inositol phosphate metabolism
aga01100  Metabolic pathways
aga01200  Carbon metabolism
aga01230  Biosynthesis of amino acids
Module
aga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aga_M00002  Glycolysis, core module involving three-carbon compounds
aga_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AgaP_AGAP001630
   00051 Fructose and mannose metabolism
    AgaP_AGAP001630
   00562 Inositol phosphate metabolism
    AgaP_AGAP001630
Enzymes [BR:aga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AgaP_AGAP001630
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AgaP_AGAP001630
  Exosomal proteins of bladder cancer cells
   AgaP_AGAP001630
  Exosomal proteins of melanoma cells
   AgaP_AGAP001630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1281542
NCBI-ProteinID: XP_321467
VectorBase: AGAP001630
UniProt: Q7PXW5
Position
2R
AA seq 247 aa AA seqDB search
MGRKFCVGGNWKMNGDKASITELCKTLSAGPLDPNTEVVVGCPAPYLSLARSLLPETIGV
AAQNCYKVAKGAFTGEISPAMLKDLGLGWVILGHSERRAIFGETDELIAEKVAHALAEGL
KVIACIGETLQEREAGQTEAVCFRQTKAIAAQVKDWSNVVIAYEPVWAIGTGKTATPEQA
QEVHAALRKWFTENVSADVSNAIRIQYGGSVTAANCRELAAKPDIDGFLVGGASLKPEFI
QIVNARQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtaagttctgcgttggaggcaactggaagatgaatggcgacaaggccagcatc
accgagctgtgcaaaacgctgtccgccggtccgctcgatcccaacaccgaggtggtggtg
ggctgccccgccccctacctgtcgctggcccgctcgctgctgccggaaacgatcggagtg
gccgcccagaactgctacaaggtggcgaagggtgcgttcaccggcgagatctcgcccgcc
atgctgaaggatcttggccttggctgggtcatcctcggtcactcggagcgacgcgccatc
ttcggcgagaccgacgagctgattgcggagaaggtcgcacacgcccttgccgaggggctg
aaggtcatcgcttgcatcggcgagacgctgcaggagcgtgaggccggccagacggaggcc
gtttgcttccggcagacgaaggccatcgccgcccaggtcaaggactggagcaatgtggtg
atcgcgtacgagccagtgtgggccatcggcaccggcaagacggccaccccggaacaggcg
caggaagtgcacgccgcgctgcgcaagtggttcaccgagaacgtgtccgccgacgtgtcg
aacgccatccgcatccagtacggcggttcggtgacggcggccaactgccgtgagctcgcg
gccaagcccgacattgacggattcctggtcggcggtgcctcgctgaagccggagttcatc
cagatcgtcaacgccagacagtag

DBGET integrated database retrieval system