KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001676
Entry
AgaP_AGAP001676   CDS       T01036                                 

Definition
(RefSeq) AGAP001676-PA
Organism
aga  Anopheles gambiae (mosquito)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 1281498
NCBI-ProteinID: XP_321420
VectorBase: AGAP001676
UniProt: Q7PXZ8
Position
2R
AA seq 376 aa
MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKM
TQIMFETFAAPAVYVAIQAVLSLYASGRTTGVVLDSGDGVSHTVPIYEGYALPHAILRMD
LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQAAAASSSSEKS
YELPDGQVITIGNERFRAPEALFQPSFLGMESTGIHETVYNSIMRCDVDIRKDLYANSVL
SGGTTMYPGIADRMQKEITSLAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQTMWISK
HEYDEGGPGIVHRKCF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtgtgacgatgatgcgggagcactggtcgtggacaacggatccggaatgtgcaaggcg
ggcttcgccggtgatgatgcgccgcgcgccgtcttcccgtccatcgttggccgtccgcgc
caccagggtgtgatggtcggcatgggcaacaaggatgcgtacgtgggcgacgaggcacag
tccaagcgcggtatactgacgctcaagtatccgatcgagcacggcattatcacgaactgg
gacgacatggagaagatctggcaccacacgttctacaacgagctgcgcgtggcgcccgag
gagcatccggtcctgctgacggaggccccgctcaacccgaaatcgaaccgcgagaagatg
acacagatcatgttcgagacgttcgccgcaccggccgtgtacgtggcgatccaggccgtg
ctgtcgctgtacgcgtccggccgtaccaccggtgtggtgctcgactcgggcgatggtgtc
tcacacaccgtgccgatctacgagggttacgcgctgccccacgcgatcctgcgcatggat
ctggccggtcgcgatctgaccgactacctgatgaagatcctgaccgagcgtggctactcg
ttcacgaccacggccgagcgggagattgtgcgcgacatcaaggagaagctgtgctacgtt
gcgctcgacttcgagcaggaaatgcaggcggccgccgcctcgtcctcgtcggagaagtcg
tacgagctgccggacggacaggtcatcaccattggcaatgagcgcttccgcgccccggag
gccctgttccagccgtccttcctcggcatggagtcgaccggcatccacgagacggtgtac
aactcgatcatgcggtgcgacgtcgacatccgtaaggatctgtacgccaacagtgtcctg
tcgggcggtactaccatgtacccgggtattgccgatcgtatgcagaaggaaattacctcg
ctcgcaccgtcgaccatcaagatcaagatcattgccccgccggagcgtaagtactccgtg
tggatcggtggctccatccttgcctcgctgtccaccttccagacgatgtggatctcgaag
cacgagtacgacgagggcggcccaggaattgtccaccgcaagtgcttctaa

DBGET integrated database retrieval system