KEGG   Anopheles gambiae (mosquito): AgaP_AGAP001698Help
Entry
AgaP_AGAP001698   CDS       T01036                                 

Definition
(RefSeq) AGAP001698-PA
  KO
K17498  transcription factor SPN1
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aga03021]
    AgaP_AGAP001698
Transcription machinery [BR:aga03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     AgaP_AGAP001698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26 PDDEXK_4 Nitrate_red_del
Motif
Other DBs
NCBI-GeneID: 1281477
NCBI-ProteinID: XP_321393
VectorBase: AGAP001698
UniProt: Q7PY14
Position
2R
AA seq 339 aa AA seqDB search
MESGLNDKRKEITTTSKKRHVDGRQFCLHYSPEDTIQDCSPNKQLMTDFDLMMILKRKKN
IYRRTGSDIDVAKRNDDQILVLLETMQQAADQDRQLNRANKPATKKIALLKHFLSQLIKK
DLQLPLLEHNVLNVLADWISPLPSKALPCLQIREGILKMLGEFPTIEKSYLKQSGIGKAV
MYLYKHPDETNANRKRAGELIHGWFRTIYNVNIELKAMSREERQQLEMKQMPANKRKTMD
SLPSAGCDQLDEALWLDKGERDTRHPGDRDWVGRARVPMPSDKAYVVRPKSKIDVDICTA
SRKQLNRYEKHLKMFNDQKRKSTMRPLVNLSNGSRNLGG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgggctcaacgataaacggaaggaaattacaacaacttccaagaagcgacat
gtagatggcagacaattctgtctacattactctccagaagataccatccaagattgttcg
ccaaataagcagcttatgacggactttgacctgatgatgattctcaagaggaagaaaaac
atttaccgtcgcaccggtagcgatatcgatgtagcaaaaagaaatgatgatcagatactg
gtgctcctggaaacgatgcaacaggcagccgaccaggaccgacagctcaaccgcgccaat
aaaccggccacaaaaaagatcgccctcctcaagcatttcctgtcgcagttgatcaagaaa
gatctgcagctgcccttgctggagcataatgtgttgaacgtactggcggattggatctca
ccactacccagcaaagcgctgccatgtttgcagattcgtgaaggcattctcaagatgttg
ggtgaattccctaccatcgaaaaatcgtaccttaagcagtccggcatcggcaaggcggtc
atgtatctgtacaaacatccagacgaaacgaatgcaaaccgcaagcgagccggagaattg
atccacggttggtttcgaacgatctataatgttaatatcgaattgaaagcgatgtctcgt
gaagaacgccagcagcttgaaatgaaacaaatgcctgctaacaagcgcaaaacgatggac
agtctgccatccgcaggatgtgatcagctagacgaggccctatggttagacaagggagaa
agagacactaggcacccgggcgatagagactgggtagggcgggcacgtgttccgatgccg
tctgacaaagcgtacgttgtgcgaccaaaatcgaaaattgatgttgatatctgtacagcg
tcaagaaaacagctgaatcgctatgaaaagcatctgaaaatgtttaatgaccagaaaaga
aagagcacgatgcgtcctttggtaaatctatccaacgggagccgaaatttgggtggctag

DBGET integrated database retrieval system