KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP001721
Entry
AgaP_AGAP001721   CDS       T01036                                 
Name
(RefSeq) AGAP001721-PA
  KO
K13249  translocon-associated protein subunit alpha
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AgaP_AGAP001721
SSDB
Motif
Pfam: TRAP_alpha
Other DBs
NCBI-GeneID: 1281453
NCBI-ProteinID: XP_321364
VectorBase: AGAP001721
UniProt: Q7PY28
Position
2R
AA seq 284 aa
MQKFFVLLLLALPAVLLTVNTGSSPFAFAAEDELDEELVDVETEDAAVVADETEPEDDLE
TTKSPDADTYLLFTRPLHASGSQLELPAGYPVEFLVGFTNKGQFEDFVVESVEASFRYAM
DFSYFIQNFSAVPYNREVKPGHEATVAYSFLPTESFAGRPFGLNIALNYRDGRGNQFSEA
VFNETVQITEVDEGLDGETFFLYVFLAAIVILLLVLGQQFLGSYGKRKRPTAARKVVETG
TASTKDVDYEWIPSETLKQLQNSPKGAPKSSPKQSPRQRKAKAH
NT seq 855 nt   +upstreamnt  +downstreamnt
atgcaaaagtttttcgtgctgctgctgctggccctgccggccgttttgctgacggtgaac
accggttcgagtccgttcgcctttgccgcggaagacgagctggacgaggagctggtcgat
gtggagacggaggatgccgccgtcgtggcagacgaaaccgagccggaggatgatctcgaa
acgaccaagtcgccggatgcggacacgtacctgctcttcacccggcccctgcacgcgtcc
ggctcgcagctcgaactgcccgctggctatccggtagagttcctggtcggcttcaccaac
aagggccagtttgaggatttcgtcgtcgagtcggtggaagcctcgttccggtacgcgatg
gacttcagctacttcatccagaacttctccgccgtgccgtacaaccgcgaggtgaagccg
ggccacgaggcgaccgtcgcgtactcgttcctgccgaccgaatccttcgccgggcgcccg
ttcgggctgaacattgcgctcaactaccgtgacggccgcggcaaccagttcagcgaggcc
gtgttcaacgaaaccgtccaaatcaccgaggtggacgaggggctggacggtgagacgttc
ttcctgtacgtattcctggccgcgatcgtgattctgctgctggtgctcggccaacagttc
ctcggctcgtacggcaagcggaaacgcccgacggcggcccgcaaggtcgtggaaaccggc
accgccagcacgaaggacgtcgactacgaatggatcccgtcggaaacgttgaagcagctc
caaaactcccccaagggtgctcccaagtcgtccccgaagcagagcccccggcagcgaaag
gcgaaagcgcactaa

DBGET integrated database retrieval system