KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP001903
Entry
AgaP_AGAP001903   CDS       T01036                                 
Name
(RefSeq) AGAP001903-PA
  KO
K00026  malate dehydrogenase [EC:1.1.1.37]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00020  Citrate cycle (TCA cycle)
aga00270  Cysteine and methionine metabolism
aga00620  Pyruvate metabolism
aga00630  Glyoxylate and dicarboxylate metabolism
aga01100  Metabolic pathways
aga01200  Carbon metabolism
Module
aga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AgaP_AGAP001903
   00620 Pyruvate metabolism
    AgaP_AGAP001903
   00630 Glyoxylate and dicarboxylate metabolism
    AgaP_AGAP001903
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AgaP_AGAP001903
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     AgaP_AGAP001903
SSDB
Motif
Pfam: Ldh_1_C Ldh_1_N 3Beta_HSD THF_DHG_CYH_C NAD_binding_10 Semialdhyde_dh DpaA_N DapB_N
Other DBs
NCBI-GeneID: 1281223
NCBI-ProteinID: XP_321163
VectorBase: AGAP001903
UniProt: Q7PYE7
Position
2R
AA seq 337 aa
MFARAVKTAACQGAKNFSTTSQNNVKVAVCGASGGIGQPLSLLLKNSPLVTELSLYDIVH
TPGVAADLSHIETQSKVTGYNGPENLEKALKGADIVIIPAGVPRKPGMTRDDLFNTNASI
VRDLAAGCAKACPKALIGIISNPVNSTVPIACDTLQKAGVLDPRRVFGVSTLDIVRANTF
VGEAAGVDPQKMSVPVIGGHSGVTIIPVLSQTKPGVNFPQDKITALTERIQEAGTEVVKA
KAGAGSATLSMAYAGARFALALARAMNGEQNVIECAYVRSDVTESKYFATPLLLGKNGLE
KNLGLPKLNAYEQELLKKAIPELKKNIQKGEEFVKKN
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgtttgcccgtgccgtgaaaactgccgcctgccagggtgcgaaaaacttttccaccacc
agccagaacaatgttaaggtggccgtttgcggtgcgtccggtggtatcggccagccgctg
tcgctgctgctgaagaacagcccgctggtgacggaactgtcgctgtacgacatcgtccac
acgcccggtgtggccgccgatctgtcgcacatcgaaacccagtcgaaggtgaccggctac
aatgggccggaaaatctggagaaggccttgaagggtgccgacatcgtcatcattccggcc
ggtgtgccccgcaagcccggcatgacccgtgacgatctgttcaacacgaacgcgtcgatc
gtgcgcgacctggcggccggctgtgccaaggcctgcccgaaagcgctgatcggtatcatc
tcgaacccggtcaactcgaccgtaccgatcgcttgcgacacgctgcagaaggcgggcgtg
ctggacccgcgccgtgtcttcggtgtctccacgctggatattgtgcgcgcgaacacgttc
gtcggtgaggcggccggtgtcgacccgcagaagatgagcgttcccgtcatcggtggccat
tccggtgtcaccatcatcccggtgctgtcccagacgaagccgggcgtgaacttcccgcag
gacaagatcaccgccctgaccgagcgcatccaggaggccggtacggaggtggtgaaggcg
aaggccggtgccggttcggccacgctgtcgatggcttatgccggtgcccggttcgcactc
gcgctggcccgtgccatgaacggcgagcagaacgtgatcgaatgtgcgtacgttcgatcg
gacgtgacggagtcgaagtacttcgcgaccccgctgctgctcggcaagaatgggctggag
aagaacctgggactgccgaagctgaacgcttacgagcaggagctgctcaagaaggccatc
ccggagctgaagaagaacatccagaagggagaggagtttgttaagaagaactaa

DBGET integrated database retrieval system