KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002194
Entry
AgaP_AGAP002194   CDS       T01036                                 

Name
(RefSeq) AGAP002194-PB
  KO
K00911  1D-myo-inositol-triphosphate 3-kinase [EC:2.7.1.127]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00562  Inositol phosphate metabolism
aga01100  Metabolic pathways
aga04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AgaP_AGAP002194
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    AgaP_AGAP002194
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.127  inositol-trisphosphate 3-kinase
     AgaP_AGAP002194
SSDB
Motif
Pfam: IPK DUF1132
Other DBs
NCBI-GeneID: 1269360
NCBI-ProteinID: XP_003436059
VectorBase: AGAP002194
UniProt: F5HIU1
Position
2R:17464878..17477310
AA seq 485 aa
MSLFTSSNSRPRSLMEALLAKKIEAASQQTGPGGSRLIRTDSMDSTSSIGSHGSLILGDD
VCRCDDCLLGIVDRYTIGPKETASGIKKPSGWRKLRNIVQWTPFFQTYKKQRYPWVQLAG
HQGNFKAGPDQGTVLKKLCPKEEKCFKVLMKDVLRPYVPEYKGQVNSEDGESTYIQLQDL
LSDFYQPCVMDCKIGVRTYLEEELSKAKEKPKLRKDMYEKMIQIDQNAPTEEEHRAKGVT
KPRYMVWRETISSTSTLGFRIEGIKKSDGTSSKDFKTTKSRDQICEAFREFTDGFPHAMP
KYIQRLKAIRATLEYSEFFKSHEVIGSSLLFVHDRHKASVWLIDFAKTVALPESVAITHD
SKWKVGNHEDGYLIGINNLIDIFSEVHDRQTLQCLTERIPRLSLPDDTNGIDANSDDPLR
HDGCNRNSEISSAAVPAVPDRCVDKIGCVNNNNNYDCKPEDQQLVGNSTADTSTGLRDCI
GSSSG
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgtcgctgtttacgtcgagcaacagcaggccgcgatccctgatggaggcgctgctggcg
aagaagatcgaggcagcgtcacagcagacgggcccgggcggatcgcggctcatccggacg
gattcgatggattcgaccagcagcatcggctcgcacggatcgctcatactcggtgacgat
gtgtgccggtgcgacgactgcctgctcgggatcgtcgatcgctataccatcgggccgaag
gaaacggcgagcggtattaaaaagccttctggatggcgtaaattgcgcaacatcgtacag
tggacaccgttcttccagacgtacaaaaagcaacgctatccgtgggtgcagctagccggg
catcagggaaacttcaaagccggaccggaccagggcacggtactgaagaagctatgcccc
aaagaggaaaagtgttttaaggtactgatgaaggatgtcctgagaccctacgttcccgag
tacaagggtcaagtgaatagtgaagatggcgaatcaacctatatacagctgcaggatcta
ctcagcgatttctatcaaccgtgcgtgatggattgtaagataggcgtccggacctaccta
gaagaggaactgtcgaaagccaaagagaagccgaaacttcgaaaagatatgtacgaaaag
atgatacagattgatcaaaacgcccccaccgaggaggagcaccgtgctaaaggtgtcacc
aagccacgctacatggtatggagggaaaccatctccagcacgtccacgctcggatttcga
atagagggcatcaaaaagagtgacggtacgagttcaaaggatttcaaaacgacaaaatcg
cgtgatcaaatctgtgaagcatttcgcgaatttactgacgggttcccgcatgcaatgcct
aaatacattcaacggttgaaggcgattcgggcaacgctcgagtattccgagtttttcaaa
agccacgaggtgataggaagctcactgttgttcgtgcacgaccgtcacaaggcaagcgtc
tggctgatcgactttgccaaaacggtcgcgcttccggagagtgtggccattacgcatgac
agcaagtggaaggtgggcaaccacgaagacggctacctgatcggaatcaacaatctgatc
gacatcttcagcgaagtgcacgatcggcaaacactgcagtgcctgacggagcgaataccc
cggctttcgctaccggacgacaccaacggtatcgatgcgaattcggatgatcctctgcgt
cacgacgggtgcaatcggaacagtgagatctcgtctgctgccgtgcccgccgtgccggac
cgatgtgtcgataagatcggctgtgtgaataacaacaacaattacgactgcaaaccagag
gatcagcagctggtgggcaacagcacggcggacacgagcacaggcctgcgtgactgtatc
gggtcgagttcggggtag

DBGET integrated database retrieval system