KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP002279
Entry
AgaP_AGAP002279   CDS       T01036                                 
Name
(RefSeq) AGAP002279-PA
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    AgaP_AGAP002279
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AgaP_AGAP002279
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     AgaP_AGAP002279
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2
Other DBs
NCBI-GeneID: 1269279
NCBI-ProteinID: XP_307899
VectorBase: AGAP002279
UniProt: Q7QKD9
Position
2R
AA seq 543 aa
MDDEQQRSMATTVVQREMMATTTTTTAAAAASIAESYAGRSIFITGATGFMGKIMVEKLL
RDCGELRCIYLLIRAKKGVDPAQRKEEYVKNIVFDHVRERYSERLGKIRLIRGDILSPGL
GLSDDDRRELTENVELVFHCAANVRFDQHIRQAVDINLNGTIRVLGLAEQMRRLVSFVHV
STAYCQCNEAVLEEKHYPAPQNPEGISKMVGLLDDDLLDIITPRLLNNLPNTYAYTKALT
EDMVYQYRGKLPIAIARPSIVTAAMKEPLPGWGEGTNGPTGLLIGAGRGVIRSMHCNGEY
LADFMPVDVTMNAIIAIGTERMANARKEDVMYYNLTSSADNPISWGEVLEMGRGILNQNP
FCFALWYPDGSIKSNYLYHLLCVVLFHYLPAYLIDFLMVLLRRKPFLVKVQKRISAGLTI
LQYYTTKEWVFRCDNTKSLYQRLSPDDRKRFYFDVNEINYKTYLYDFILGARQYILKEAP
ETLPKARKLLRKLYIMDKIVQIGLYLFGLWLAWTYLEVVTGSIQFVFDTAIESLRGTTVR
QGL
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggacgacgagcagcagcgctcgatggcgacgacggtggtgcaacgggagatgatggcg
accaccaccaccaccaccgctgcagccgccgccagcattgccgaatcgtacgccggccgg
tcgatcttcatcaccggtgcgaccggtttcatgggcaaaattatggtggaaaagctgctg
cgcgactgtggcgagctgcgatgcatctatctgctgatacgcgcgaaaaagggcgtcgat
ccggcccagcgcaaggaggagtacgtgaagaacatcgtgttcgatcacgtgcgcgaacgg
tacagcgagcggctcgggaagatacggctgatacgcggcgacatactgagcccgggcctc
gggctgagcgacgacgatcgccgcgagctgaccgagaacgtcgagctggtgtttcactgt
gccgcgaacgtgcgcttcgaccagcacatccggcaggcggtggacatcaacctgaacggc
acgatccgggtgctcgggctggcggaacagatgaggcggctcgtgtcgttcgtgcacgtg
tcgaccgcctactgccagtgcaatgaggcggtgctggaggagaagcactacccggcaccc
cagaacccggagggcatctcgaagatggtcggtctgctcgatgacgatctgctcgacatc
ataacgccaagactgctgaacaacctgccgaacacgtacgcgtacacgaaagcgctcacc
gaggacatggtgtaccagtaccggggcaagctgccgatcgccatcgcccgcccgtcgatc
gtaacggccgcgatgaaggaaccgctgcccgggtggggcgagggcaccaacggcccaacc
gggctgctgatcggggccggccgcggcgtcatccgcagcatgcactgtaacggcgagtat
ctggccgactttatgccggtggacgtgacgatgaacgcgatcatcgcgatcggcacggag
cggatggcgaacgcgcgcaaggaggacgtgatgtactacaatctcacctcgtccgccgac
aacccgatcagctggggcgaggtgctggaaatggggcgcggcatactgaaccagaatccg
ttctgcttcgccctctggtatccggacgggtcgatcaagtccaactatctgtaccatctg
ctgtgtgtcgtactgttccactatctgccggcgtacctgatcgactttctgatggtgctg
ctccgtcgcaaacccttcttggtgaaggtacagaaaaggatatcggccggactgacgata
ctgcagtactacacgaccaaggaatgggtcttccggtgtgacaatacgaaatcgctctac
cagcggctgtcgccggacgatcggaagcggttctacttcgacgtgaacgaaatcaactat
aagacctacctgtacgatttcattctcggcgcccggcagtacatcctgaaggaggcgccc
gaaacgctaccgaaagcaaggaagctgctgcgcaagctctacatcatggacaagattgtg
cagattggactgtacctgtttggtctgtggttagcttggacgtatctggaggttgtgacc
ggctcgattcagttcgtgttcgacaccgctatcgagagtctgcgcggcacgaccgtacgg
cagggactttga

DBGET integrated database retrieval system