KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002315Help
Entry
AgaP_AGAP002315   CDS       T01036                                 

Definition
(RefSeq) AGAP002315-PC
  KO
K17890  autophagy-related protein 16-1
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04136  Autophagy - other
aga04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:aga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    AgaP_AGAP002315
   04136 Autophagy - other
    AgaP_AGAP002315
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aga04131]
    AgaP_AGAP002315
   03029 Mitochondrial biogenesis [BR:aga03029]
    AgaP_AGAP002315
Membrane trafficking [BR:aga04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    AgaP_AGAP002315
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    AgaP_AGAP002315
Mitochondrial biogenesis [BR:aga03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    AgaP_AGAP002315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 DUF4201 PALB2_WD40
Motif
Other DBs
NCBI-GeneID: 1273655
NCBI-ProteinID: XP_003436086
VectorBase: AGAP002315
UniProt: F5HK85
Position
2R
AA seq 544 aa AA seqDB search
MAKMQENWRDIIADRLRERNKNESARFADIIHYNNRLFDTAAKLRQENLDLKIDRKIRDS
VNVSGAGGGGTTFGTDVATITNAQIQSLEKKVLAQQEELTDLHKRKGEHSQMVITLNQKL
TELQRLLAEKERALADQTALCASLKEELDEMKASHVTIKDESLASQLRANTAEDKLRAVQ
DENTKLLNLLMEYKSRDAEIMNKENDKFVKEKKARIESELERAIRDIPGPSSIGADLDRF
DVDGLPEGVEFKFDAHDGEVNAVRWSPIERIVATGGADRKVKLWDVGKGVCEQRGVLVGS
NQGINSVEFDTTGSMILAASNDSASRMWSVVDHRLRHTLTGHSGKVLAAKFLGSAFLVTG
SHDRTLKIWDLKNRSCTETKFAGSSCNDLVTTDSFSFISGHVDKKIRFWDVRTADCTAND
IPLQGKITSLDLSKDGKFLLSCVRDDTINLLDLRQNRIVRTFRNDNFKVGCDWSRVAFSP
SSSRIAAGSADGSVYIWNINGPLETVLKDPNGSGAAVTAVSWHPFSSTLASVDRAKKCTI
WSNA
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaatgcaggaaaactggcgcgacatcattgccgatcggttgcgcgagcgaaat
aaaaacgaatcggcacggtttgccgacatcatccattacaacaaccgactgttcgatacg
gccgccaagcttcggcaggaaaatttggatttgaaaattgatagaaaaatacgcgacagc
gtcaatgtgagtggggcgggcgggggcggcaccaccttcggcacggacgtagccaccatc
acgaacgcccagatccaatcgctcgagaagaaagtgctggcccagcaggaggagctgacg
gatctgcacaaacgcaagggcgaacattcgcagatggtgataacgctcaaccagaagctg
accgagctgcagcgcctgctggccgagaaggagcgggcgctggccgaccagacggccctt
tgcgcttcactgaaggaagagctggacgagatgaaagcatcacacgttacgattaaggac
gaatcgctcgcatcgcagctgcgcgccaacacggccgaggacaagctgcgggccgtgcag
gacgaaaacacgaagctgctcaacctgctgatggagtacaagtcgcgggacgccgagatc
atgaacaaggagaacgataagtttgtgaaggagaagaaggcacgcatcgagagcgagctg
gagcgggcgatacgcgacattcccggcccgtcctcgatcggtgccgatctggaccggttc
gatgtggacggtttaccggagggcgtagagtttaagttcgacgcccatgatggggaggtg
aatgcggtgcgctggagcccgattgagcgtatcgtcgcgaccggtggggccgaccggaag
gtgaagctgtgggatgtgggaaaaggtgtttgtgaacaacgtggcgtgctagtgggcagc
aatcaaggcatcaattcggtggagttcgatacgactggttcgatgatattggccgcctcg
aacgactctgccagccgcatgtggtcggtcgtggatcatcgattaaggcacaccctaacc
ggacacagcggaaaggtgctggcggcgaagttcctcggttccgccttcctcgtcaccggc
agccacgatcggacgctcaaaatatgggacctcaaaaatcgttcatgtacggagacgaaa
tttgctggctcgagctgcaacgatctagtcacgacggacagcttctccttcatcagtggc
cacgtggacaagaagatacgcttctgggacgtgcggacggccgactgtacggcgaacgac
ataccgctgcagggcaaaattacctcgctcgacctgtcgaaggatgggaagtttttgctg
agctgcgtacgggacgacacgatcaacctgctcgacctgcgccagaaccgtatcgtgcgc
acatttcgtaacgataattttaaagttggatgcgactggtcccgggtggcgttcagccca
tcgagctcacgcattgcggccggttcggccgatggttcggtgtacatttggaacattaac
ggaccgctcgagacggtgctgaaggatcccaatggaagcggtgcggccgtcacggccgtc
agctggcacccgttcagctccacgctggcctcggtcgatcgggccaaaaagtgtacgatc
tggtcgaacgcctaa

DBGET integrated database retrieval system