KEGG   Anopheles gambiae (mosquito): AgaP_AGAP002504Help
Entry
AgaP_AGAP002504   CDS       T01036                                 

Definition
(RefSeq) AGAP002504-PA
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aga03016]
    AgaP_AGAP002504
Enzymes [BR:aga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     AgaP_AGAP002504
Transfer RNA biogenesis [BR:aga03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    AgaP_AGAP002504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ
Motif
Other DBs
NCBI-GeneID: 1273458
NCBI-ProteinID: XP_563662
VectorBase: AGAP002504
UniProt: Q5TTT3
Position
2R
AA seq 707 aa AA seqDB search
MGKPKHMTNKQNPFAKKKRNNKEKAAEAPVRRDKPYESIVLENESFEAYYKHQQICGSDA
EWDQFMAHMRRNLPVTFRITGSKAQAQLLLKLIKEDFFEEYFRAVKELRKEEPDALVEPP
RCLEWYPREMAWQLELSRKDIRRSEPLFKLHNFLISETSSGYISRQEAVSMIPPLVLGVE
PHHKVLDMCAAPGSKTAQLIESLHAGDGGTIPSGFVMANDVDNNRCYMLVHQAKRLNSPC
FVVTNGDSSTFPSMQYTKDDGTVSPLKFDRVLCDVPCSGDGTLRKNADIWNKWNLAQASN
LHGLQYRILKRGAELLEVGGKLVYSTCSLNPIENEAVLHHLLKESDDSLEIVECSGALPT
LKYSTGLTYWEPASKDLTFYKSFEEVPESQRTVLRPGMFPPPKEEAVNRYHLDRCLRILP
HQQNTGGFFVALLEKKKPLPWETVTAVVGADGQESSETAIVEPPQKKTKYMRGFKEDPFV
FFDEKEEVFDSLNKFFQLSADFEPRNLLTRCKVGKKKNVYFCSSIVRDIVQLNEKRIKMI
NLGVKSFVRCATRNIECDFRLASEGLANVNAYIGSQRRVMVQKQDLIALLSCTDPTRPPE
ISSLTAETQKNLQGVASGSCVLECMVEDVKLATVGWKGAMSLRAYVDQYDTVHMLRLLGG
DLTKFEKNKFQDKRDAVEAQEDDEQDANDDMAADDAESAAVQEESNE
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaccaaaacacatgacgaacaaacagaacccgtttgcgaagaagaaacgcaac
aacaaggaaaaggccgctgaagctccggtgcgtcgagacaagccgtacgaaagcatcgtg
ctagagaatgaatcgttcgaagcgtactacaagcatcagcagatctgcggtagcgatgcc
gagtgggaccagtttatggcgcacatgcgaagaaaccttccggtaacgttccgcatcacc
ggctcgaaggcacaggcccagctgctgctgaagctgatcaaggaagacttcttcgaagag
tacttccgggcggtgaaggagctgcgcaaggaagagccggacgcgctggttgagccgccc
cgttgcctcgagtggtatccgcgggaaatggcctggcagctggagctgtcgcgcaaagac
attcgccggtccgagccactgttcaagctgcacaactttctcatctcggaaacgagctcg
ggctacatcagccggcaggaggcggtctcgatgataccgccgctagtgctgggcgtggag
ccgcaccacaaggtgttggacatgtgtgcggcacccggttcgaagacggcacagctgatc
gagtcgctacacgccggcgacggtggcaccataccgtccgggttcgtcatggcgaacgat
gtggacaacaaccggtgctacatgctggtgcaccaggcgaagcgcctcaactcgccgtgc
tttgtggtaacgaacggggacagctcgacctttccctcgatgcagtacacgaaggacgac
ggtacggtgtcgccgctgaagttcgatcgggtgctctgcgacgtaccctgctcgggcgat
ggaacgctgcggaaaaacgccgacatctggaacaagtggaacctggcccaggcgtccaat
ctgcacgggctgcagtaccgcatactgaagcgcggggccgagctgctcgaggtaggcggc
aagctcgtctactcgacctgctcgctgaacccgatcgagaacgaggccgtcctgcaccac
ctgctgaaggagtcggacgattcgctggagattgtcgagtgcagtggtgcgctgccgacg
ctcaagtattccaccggtctaacctactgggagccggcgtcgaaagatttaacgttctac
aaatcgttcgaggaggtgcccgaatcgcagcgaaccgttctgcggcccggcatgtttccg
ccgccgaaagaggaagccgtgaacaggtatcatctcgatcgctgcctgcgcatcttgccg
caccagcaaaacacgggcggcttctttgtggcgctgctcgagaaaaagaaacccctgccc
tgggaaacggtcacggcggtggtgggggcggacggacaggaatcgtccgaaactgccatc
gtggaaccgccgcagaagaaaacgaagtacatgcgtgggttcaaggaagatccgttcgtg
tttttcgacgagaaggaggaggtgttcgactcgctcaacaagttcttccagcttagtgca
gactttgagccgcggaatctacttacgcgatgcaaggtgggtaagaagaaaaatgtgtac
ttctgttcgagcattgtgcgtgatatcgtgcagctgaacgagaagcgcataaagatgatc
aatctcggcgtgaagtcgttcgtacgctgcgccacacgtaacatcgagtgcgactttcgg
ctcgccagtgaagggctggccaatgtgaatgcgtacattggcagtcagcgtcgcgtgatg
gtgcagaagcaggatttaatcgcgctgctgtcatgcaccgatcctaccagaccgcccgaa
atttcctccctcactgctgaaacgcagaagaaccttcagggtgttgcgtccggcagctgc
gtactcgaatgtatggtagaggatgtaaaactagccacggtcggatggaagggagcgatg
agcctgcgagcgtacgttgatcagtacgatacggtgcacatgctccggctgctcggtgga
gatcttacgaaattcgaaaaaaataaattccaagacaaacgtgacgcagtggaagcccag
gaggacgatgaacaggatgcgaacgacgatatggctgccgacgatgccgagtcagcagcc
gtgcaggaggaatctaacgagtag

DBGET integrated database retrieval system