KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP002711
Entry
AgaP_AGAP002711   CDS       T01036                                 
Name
(RefSeq) AGAP002711-PF
  KO
K06091  MAGUK p55 subfamily member 5
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:aga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04391 Hippo signaling pathway - fly
    AgaP_AGAP002711
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:aga04990]
    AgaP_AGAP002711
Domain-containing proteins not elsewhere classified [BR:aga04990]
 PDZ domain-containing proteins
  MAGUK family proteins
   AgaP_AGAP002711
SSDB
Motif
Pfam: Guanylate_kin PDZ SH3_2 PDZ_6 PDZ_2 SH3_1 L27 Peptidase_M50 SH3_9
Other DBs
NCBI-GeneID: 1273257
NCBI-ProteinID: XP_003436217
VectorBase: AGAP002711
UniProt: F5HKP1
Position
2R
AA seq 1285 aa
MQQRTTTPAAGPPPPTASSSGKQVVELNGYVIILVESRDGKIKLYGSPADKDNLEVADEI
LDVNERKLEDSPRAEVIKHIHECIQSCMIKLRVKRRSDSRLAGELGNAVQDAFVIAVEQQ
ARERLQRLSALKRITPVDMSQLSIKASISPTSHLIALNQQSQAKGGGTQDLSFLKEASPI
YVTSLASNSVTGTNTSTTVTAGVKTTFPAGANNTINNNTLNNNNNSTVGGGGVLMQNATN
NNGTTNLSSTTNTTGSSSTSGNATRLQQPGTTGMQVNVVTGQPGTGALVAVAASKGLSAL
DQPIPGNNNNGSGSTLGGGAALAGTSAYHSLHQHSLVNNNNLNSSNIGKPQGLDATANSY
YSNLTNTFLANGHGSKRELATLSEGELEPPDEPQYESSGNISRGGTEVLLGDQNLRQENR
PRRRSGSSIVVLGGDDTLKPSIPIDDYQEDLEMYNMLAANQDNGPHREMAVDVPESFIAR
NKTPPRYPPPRSTVTAASAAASTPATPASTQLNGSSKPVPPPRDHLRIEKDGRLTNRAPV
PAPQVPDRKIVPNASSQHQHIGQVLEPTPDQLDSIKKFQEQLRRRREDEERIAAQNDFLR
NSLRGSQRLRALQDNPIEKPPVGVDNEAYADDEVVAVAAEKIIGYGELVAALQRLQGHLN
KHGLAALAGRVTAAQSLLLGPGIARALAVRTAVLERRRPKIPNPICPNAQALAKDCVESL
AQSRSQTAIELCDLLSTYEMEGLLLAHDRIASTTDRSPIASYGGSPITVPVPLGTASNNT
TSNNTTTSNNSINNNTLTSAVKPATVMPSIPNNASLVNNNNNNIAKREPMSVPLGVLRDG
SQDHIKIIQIEKSSEPLGATIRNEGEAVVIGRVVRGGAAEKSGLLHEGDEILEVNGIEMR
GKSVNDVCALLGSMTGTLTFLVVPAGVPQILPGLGMRDPPVLHVRAHFDYDPEDDLYIPC
RELGISFQKGDVLHVISRDDPNWWQAYREGEEDQTLAGLIPSQSFQHQRESMKLAIAGEV
GLRTRKDINGKAGGGSTLLCARKGRKKKKKASSEHGYPLYATATADDPDPEEILTYEEVA
LYYPRASHKRPIVLIGPPNIGRHELRQRLMADSERFAAAIPHTSRAQREGEVPGQDYHFI
SRQQFESDILARKFVEHGEYEKAYYGTSLEAIRAVVASGKICVLNLHPQSLKLLRSSDLK
PYTVLVAPPSLEKLRQKRIRTGEPYKEEELKEIIATARDMEARWGHLFDMIIINNDTERA
YHQLLAEINSLEREPQWVPSSWLHN
NT seq 3858 nt   +upstreamnt  +downstreamnt
atgcagcaaaggacgaccacgccagcagctggccccccaccaccgaccgcttcgtcgtcg
ggcaagcaagtggtcgagctcaacgggtacgtgataattctggtcgaaagccgggatggc
aaaatcaaactgtacggcagcccggccgacaaggacaacctggaggtggcggacgagata
ttggacgttaacgagcgcaaactggaggactcgccgagagccgaagttatcaagcacata
cacgagtgcatccagtcgtgcatgataaagctgcgcgtcaaacggcgaagtgattctcgt
ttagcgggcgagctgggcaatgccgtgcaggatgcgtttgtcatcgccgtcgagcagcag
gcccgggagcgccttcagcgattgtccgcgctcaagcggattacaccggtcgacatgtca
cagctttcgatcaaagcaagtatctcccctacctctcacttgatagcactcaatcagcaa
agccaggcgaagggtggcggcacgcaagatctcagcttcctgaaggaggcatcgcccatc
tacgtgacgtcactcgcgagcaacagtgttacgggtacgaacaccagcacgacggtaacg
gccggtgtgaagacgacatttccagcgggggccaacaacaccatcaacaacaacaccctc
aacaacaataataacagcacggtgggaggcggcggtgtactgatgcaaaatgcaaccaac
aacaatggcaccactaacctgtccagcaccactaacaccaccggcagcagcagcaccagc
ggcaacgcgacccggctgcagcaacccggtaccaccggaatgcaggtgaacgtggtcact
gggcagccgggaacgggcgcattggtggcggtcgcggcgtccaaagggttgtccgcgctc
gaccagcccatcccgggcaataacaacaacggcagcggcagtacactcggtggcggtgcc
gcactggccggtacgtccgcctaccacagcctgcaccagcacagtcttgtaaataacaac
aacctcaacagcagcaatatcggcaaaccccaagggcttgacgcaaccgccaacagttac
tatagtaatctaactaacaccttcctagcgaacggtcatggttccaagcgagagctggct
acactgtccgagggagagctcgagccgccggacgaaccgcagtacgagtcgagcggtaac
atatcgcgcggtggtaccgaagtgctgctgggagatcagaaccttcgccaggagaatcgg
cctcgcagacgcagcggctccagcatcgtggtgctgggcggtgatgacaccctgaagccc
tccatacctattgatgactatcaggaggacttggaaatgtacaatatgttagcggcaaac
caggataatggaccacaccgggaaatggctgtcgatgtacctgaatcgttcatagccaga
aacaaaacgcctccgcgctacccaccgccacgcagcacggtgacggcggcgtcggcggcg
gccagcacaccggcaacacccgcgtccacccagctcaatggctcgtcgaaaccggtgcca
ccgccccgggatcatctgcggatagagaaggacggccggctcaccaatcgcgcaccagta
cccgctccacaagtgccagatcgtaagattgtgccgaacgcatcatcacagcaccagcat
atcggccaggtcctggaaccgaccccggatcagttagatagcattaagaagttccaggag
caactgcgacggcgaagggaggacgaggagcggatagcggcccagaatgacttcctgcgg
aacagtttgcgcggctcgcagcggctccgcgcgctgcaggacaacccgatcgagaagccg
ccggtcggcgtcgacaacgaggcgtacgcggacgatgaggtggtggcggtggcagcggag
aagattatcgggtacggcgagctggtggcggcactgcagcgactccaggggcacctcaac
aagcacggcctggcggcactcgctggcagggtgacggcagcccagagcctgctgctcggt
ccgggcatcgcgcgggccctggccgtccggacggcggtcctcgagcggcggcgcccgaag
ataccgaaccccatctgccccaatgctcaagcgctagcaaaggattgcgtcgaatcgctg
gcccagtcccgctcgcaaaccgcgatcgagctgtgcgatctgctgtccacgtacgagatg
gagggtctgctgctggcgcacgatcggatcgcctcgaccacggaccgttcgccgatcgct
tcgtacggtggcagcccgatcaccgtcccggtgccgctcggcacggccagcaacaacacc
accagcaacaacaccaccaccagcaacaacagcatcaacaataacaccttgaccagtgcg
gtgaaaccggccactgtcatgccatcaattccaaataacgctagtttagtgaacaataac
aataacaacatcgctaagagggaaccaatgagtgtaccgctcggggtgctgcgcgacggc
agccaggaccacatcaagatcatccagatcgaaaagtcgtccgagccgctcggtgccacc
atccggaacgagggcgaagcggtcgtgatcgggcgggtcgtacggggcggtgcggccgaa
aagtccggcctgctgcacgagggcgacgaaatactggaggtaaacgggatcgaaatgcgc
ggcaagtcggtgaacgatgtgtgcgccctgctcggctcgatgaccggcacgctcacgttt
ctggtcgtgccggcgggcgtaccgcagatactgcccgggctcggtatgcgcgatccgccc
gtgctgcacgtgcgggcccacttcgactacgatccggaggacgacctgtacataccgtgc
cgggagctgggcatcagcttccagaagggtgacgtgctgcacgtgatctcgcgcgacgat
ccgaactggtggcaggcgtaccgggagggcgaagaggatcaaacgctcgccgggctgata
ccgagccagtcgttccagcatcagcgcgaatcgatgaagctggcgatcgcgggcgaggtg
gggctgcgcacgcgcaaagacatcaacgggaaggcgggcggcggctcgaccctgctgtgc
gcccgcaagggacggaagaagaagaagaaggccagcagcgagcatgggtacccgctgtac
gcgaccgccaccgcggacgatcccgacccggaggagatactcacgtacgaggaggtggca
ctgtactacccgcgtgcctcccacaagcgaccgatcgtgctgatcgggccgccgaacatt
gggcggcacgagctgcgccagcggttgatggcggattcggagcgctttgccgcggccatt
cctcatacgtcacgagctcagcgggagggcgaagtgccgggccaggactatcacttcatc
tcgcggcaacagttcgagtcggacatcctggcccgcaagtttgtcgagcacggtgaatac
gagaaagcgtactatggcacatcgctggaagcgatccgagcggtggtcgctagcggcaag
atatgtgtgctgaatctgcacccccagagccttaagctgctgcgctcgtccgatctgaag
ccatacaccgtgctggtggcaccgcccagcctggaaaagctgcgccaaaagcggatacga
accggtgaaccttacaaggaagaagaactgaaggaaatcattgccaccgcacgcgacatg
gaggcacgctggggccatctgttcgatatgatcatcatcaacaatgataccgagcgggcg
taccatcagctgctggccgagatcaattcgctcgagcgggaaccgcagtgggtcccgagc
agctggctgcacaactag

DBGET integrated database retrieval system