KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP002721
Entry
AgaP_AGAP002721   CDS       T01036                                 
Symbol
T23O_ANOGA
Name
(RefSeq) AGAP002721-PA
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00380  Tryptophan metabolism
aga01100  Metabolic pathways
aga01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AgaP_AGAP002721 (T23O_ANOGA)
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     AgaP_AGAP002721 (T23O_ANOGA)
SSDB
Motif
Pfam: Trp_dioxygenase FdhE
Other DBs
NCBI-GeneID: 1273245
NCBI-ProteinID: XP_312204
VectorBase: AGAP002721
UniProt: O77457
Position
2R
AA seq 392 aa
MSCPMRSGFVDSVQGGHHLGSEAGMLYGEYLMLDKVLSAQRMLSVEGKKPVHDEHLFIVT
HQAYELWFKQIIFELDSIRDLFSTEHIEESRTLEILKRLNRIVMILKLLVDQVPILETMT
PLDFMDFRDYLSPASGFQSLQFRLLENKLGVKSEHRVKYNQKYTEVFASDPGAIERIGTT
ETEPSLADLVQKWLERTPGLEQDGFNFWGKFQESVEQLLAEQEASAMSEEHENVREYRLM
DIDKRREVYKSIFDAQVHDALVARGERRFTHKALQGAIMITFYRDEPRFSQPHQLLMLLM
DIDSLITKWRYNHVIMVQRMIGSQQLGTGGSSGYQYLRSTLSDRYKVFLDLFNLSTFLIP
RQSIPPLTNEMQKALNLAWGSPAHFARNGSLH
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgagctgcccaatgagaagtggttttgtcgattcggtgcagggtggacaccatctcggg
tcggaggcgggcatgctgtacggcgagtacctgatgctggacaaggtgctcagtgcgcag
cgcatgctgtccgtcgagggcaagaagcccgtgcacgacgagcatctgttcatcgtgacg
catcaggcgtacgagctgtggttcaagcagatcatcttcgagctggattcgattcgcgat
ctcttcagcaccgagcacatcgaggagtcgcgtacgctcgagattctgaagcgtctcaac
cggattgtgatgattctgaagctgctggtggatcaggtcccgatcctcgaaacgatgaca
ccgctcgactttatggactttcgcgactacctgtcgccggcgtccggcttccagagcctg
cagttccggctgctggagaacaagctcggcgtaaagtcggaacaccgcgtcaagtacaac
cagaagtacacggaggtgtttgccagcgatccgggcgcgatcgagcggatcggtaccacc
gagacggaaccgtcgctggccgatctggtgcagaaatggctggagcgtacgcccgggctg
gagcaggatgggtttaacttctggggcaagtttcaggagagcgtcgagcagctgctggct
gagcaggaagcgagcgcaatgtcggaagagcatgagaacgtgcgcgagtatcggctgatg
gacattgacaagcggcgcgaggtgtacaagtccatctttgacgcgcaggttcacgatgcg
ctggtggcccgcggtgagcgtcgcttcacgcacaaggcgctgcagggtgcgatcatgata
acgttctatcgcgacgagccacggtttagccagccgcaccagctgctaatgctactgatg
gacatcgattcgctgatcaccaagtggcgatataaccacgtcattatggtgcagcgtatg
attggctcgcagcagcttggcaccggtggctcttctggatatcagtacttacgttcaacc
ttaagcgatcggtataaagtgtttctcgatctgttcaacctgtccacgttcctgatccct
cgccagtcgataccaccgctcacgaacgagatgcagaaagcgctcaacctcgcctgggga
tcgccggcccacttcgcacgcaacggttcgttgcactaa

DBGET integrated database retrieval system