KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP002809
Entry
AgaP_AGAP002809   CDS       T01036                                 
Name
(RefSeq) AGAP002809-PA
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00061  Fatty acid biosynthesis
aga00780  Biotin metabolism
aga01100  Metabolic pathways
aga01212  Fatty acid metabolism
aga01240  Biosynthesis of cofactors
Module
aga_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AgaP_AGAP002809
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AgaP_AGAP002809
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aga01004]
    AgaP_AGAP002809
Enzymes [BR:aga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     AgaP_AGAP002809
Lipid biosynthesis proteins [BR:aga01004]
 Fatty acid synthase
  Component type
   AgaP_AGAP002809
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Other DBs
NCBI-GeneID: 1273152
NCBI-ProteinID: XP_312104
VectorBase: AGAP002809
UniProt: Q7QCU6
Position
2R
AA seq 459 aa
MMGPNAHSYCLLRARKSLPYVLRTIHHSHSKHTRDSGRRRVVVTGLGVVSPVGCNVEAAW
QTILSGQSKVGRLVGETYDKLPCRVAATIDTNDIDLEKCFSKTELKTMARATAFALIAAK
EALSRASWMPGVEDETACQRTGVAIGMGMVDLMDICETNEALKKGYNRVSPFFVPRILPN
MPAGQLSIRYGFRGPNHAVSTACATGAHAIGDAFRFIQHGDADVMVCGGAEACISPLGIA
GFCRLRALSTAFNDEPTASSRPFDERRDGFVMGEGSAIFVLEELQHALRRGAPIYGEILG
YGLSGDASHLTAPREDGTGALLAMQRALADGGVTVADIGYVNAHATSTPIGDAIEARAIR
TLFGEHTRSLAVSSTKGAHGHLLGAAGNLEALFVVMACRHGLLPPTVNLQNVTDDMAGLH
YVANSSEPWEGKHRRRVALKNSFGFGGTNACLCIGEYSE
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgatgggaccaaacgctcacagctactgtttgctgcgcgcacggaaaagtctcccctac
gtgctgcgaactattcaccattcacactcgaaacacaccagagacagtggacgacgccgg
gtggtggtaacggggctcggtgtagtatcacctgtcggctgcaatgtggaagcggcctgg
caaacgatcctctccggtcagtcaaaagttggtcgactggtgggagaaacgtacgacaag
cttccctgccgcgtagcggccacaatcgacacgaacgacatcgatctggaaaagtgtttc
tccaaaaccgagctcaaaacgatggcacgcgctaccgcctttgcgttgatcgctgccaag
gaggctctctcgagggctagctggatgccgggcgtggaggatgaaaccgcctgccagcgc
accggtgttgccatcggtatgggcatggtagatctgatggacatttgcgagacgaacgaa
gcgctcaagaagggatacaaccgggtgagcccattttttgtgccccgcatcttgcccaac
atgccggccgggcagctcagcatccggtacgggtttcgcggaccgaaccatgccgtttct
accgcctgtgctacgggtgcccatgccataggcgatgcgttccgcttcattcagcacggc
gatgcggacgtgatggtgtgtggcggtgcggaagcttgcatcagtccgctcgggattgcc
ggattctgtcggctgcgagcgctcagcacggcgttcaacgacgaaccgacggcatcgtcc
cgaccgttcgacgagcgtcgcgatggctttgtgatgggcgaggggtcggccattttcgtg
ctggaagagctgcagcatgccctgcggcgaggagcaccaatctacggcgagatactcggg
tatggattgtctggcgatgcgtcccatctgacggcaccgcgggaggatgggacgggagcg
ctgttggcgatgcagcgagcccttgccgatggtggcgtaacggttgccgatattgggtac
gttaatgcacacgccacatcgaccccgatcggtgatgcgatagaagcccgtgcgataagg
acacttttcggagagcacacacggtcgctggcggtttcgtcgacaaagggagcccatggt
catttgctcggtgcggccggcaacttggaagcgctgttcgtcgtgatggcctgcaggcat
ggtctgcttccacccaccgtcaatctgcagaacgtaacggacgatatggccgggctgcat
tacgtggcgaacagctccgaaccatgggaggggaagcaccgtcggcgggtggctttgaaa
aactcgttcggttttggtggcaccaacgcttgtctctgcattggtgaatacagcgaataa

DBGET integrated database retrieval system