KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP003216
Entry
AgaP_AGAP003216   CDS       T01036                                 
Name
(RefSeq) AGAP003216-PA
  KO
K03062  26S proteasome regulatory subunit T2
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga03050  Proteasome
Brite
KEGG Orthology (KO) [BR:aga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    AgaP_AGAP003216
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:aga03051]
    AgaP_AGAP003216
Proteasome [BR:aga03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     AgaP_AGAP003216
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB AAA_2 AAA_22 DUF815 RuvB_N AAA_5 AAA_16 Prot_ATP_OB_N AAA_18 AAA_25 AAA_33 IstB_IS21 RNA_helicase AAA_28 AAA_14 AAA_3 ATPase TIP49 Mg_chelatase AAA_7 AAA_24 PhoH AAA_30 NACHT NB-ARC ABC_tran Parvo_NS1 TsaE Sigma54_activat
Other DBs
NCBI-GeneID: 1273891
NCBI-ProteinID: XP_312924
VectorBase: AGAP003216
UniProt: A0T4G5
Position
2R
AA seq 438 aa
MGQNQSAGSGGDKDKDKDKKKKYEPPIPTRVGKKKRKAKGPDAALKLPQVTPHTRCRLKL
LKLERIKDYLLMEEEFIRNQERLKPQEEKIEEERSKVDDLRGSPMSVGTLEEIIDDNHAI
VSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAPQE
TYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQ
TSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGE
REIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKR
RIFNIHTARMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKS
KESVLYRKKEGTPEGLYM
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgggccaaaaccagtcagcgggaagcggcggggacaaggataaggataaggataagaag
aaaaagtacgagccaccgattccgacgcgggttggcaaaaagaagcgcaaggcaaaggga
cccgatgcggccctcaagctgccccaggtcaccccacacacgcgctgccggctgaagctg
ctcaagctggagcgcatcaaggactatctgctgatggaggaggagttcatccgcaaccag
gaaagactgaagccgcaggaggaaaagatcgaggaagagcgctccaaggtggacgacctg
cgggggtcgcccatgtcggtcggcacgctggaggagatcatcgacgataaccacgcaatc
gtgtcgacgtcggtgggcagcgagcactacgtcagcatcctgtcgttcgtcgacaaggac
cagctggaaccgggctgctcggtgctgctgaaccacaaggtgcacgcggtggtcggagtg
ctgggcgacgacaccgacccgatggtgacggtgatgaagctggagaaagcaccgcaggaa
acgtacgccgacatcggcgggctggacacgcagatccaggagatcaaggaatcggtcgag
ctgcccctcacgcaccccgagtactacgaggagatgggcatcaaaccgccgaagggtgtg
atcctgtacggaccgccgggcacgggcaaaacgctgctcgcgaaggcggtggcaaaccag
acgtccgccaccttcctgcgagtcgttgggtcggagctgattcagaagtatctcggcgac
ggtcccaagctggtgcgcgagctgttccgtgtggccgaggagcacgccccgtcgatcgtg
ttcatcgacgaaatcgatgccgtcggaacgaagcggtacgattccaactcgggcggtgag
cgcgaaattcagcgcaccatgctggagttgctcaaccagctggacgggtttgactcgcgc
ggcgatgtgaaagtaatcatggccacgaatcgtattgaaacgctcgacccggcactgatc
cgtccggggcgtattgatcgaaagattgagttcccgctgccggacgagaagaccaagcga
cgtatcttcaacatccacactgcccgtatgacgctggcggaggacgtgaatctgtcggag
ttgatcatggcgaaggacgatctgtcgggcgcggacatcaaggccatctgcacggaggcg
ggcttgatggcgctgcgggagcgccgaatgaaggtgaccaacgaggactttaagaagtcc
aaggagagtgtgctctaccggaaaaaggagggaacgcccgagggactttatatgtaa

DBGET integrated database retrieval system