KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003555Help
Entry
AgaP_AGAP003555   CDS       T01036                                 

Definition
(RefSeq) AGAP003555-PA
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00010  Glycolysis / Gluconeogenesis
aga00562  Inositol phosphate metabolism
aga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AgaP_AGAP003555
   00562 Inositol phosphate metabolism
    AgaP_AGAP003555
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     AgaP_AGAP003555
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     AgaP_AGAP003555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 1274214
NCBI-ProteinID: XP_313302
VectorBase: AGAP003555
UniProt: Q7PQI2
Position
2R
AA seq 451 aa AA seqDB search
MLLRTGPNIVLLLALLVSFSSILLSSSVGAERWCANNPKDTIFRRLGTKTPYRHVQNKDV
RSIATVNGCTVSKIWGLFRHGTRNPSKSIIDHMRTTLPELQRDILEHGHICRDQLELFER
WQPRVTVEDAKLLVREGGDELFQLGQRIRKRFGTHIPERYDEHDFRFKFTKTERAEYSAR
NFSHGLFGRDEPIQYPEALHRDPVLRFYKGCEKWKKQVKQNPYSYREMDRFGSSKQMRSV
IEKLSKRIGTFVSPEEVHAIYQTCAFETAWSDRDISPWCLLFDKESISTMEYNEDLKYYW
IDGYGYDLTHRQACSAFADLFTNFNDENGPRFTFYFTHSGTLLKSIAFLNLYKDNEPLRG
ENMRHKRKWRVSHIDAFGTNLYFVLYGCPDGTQSIALYHQERLTNIPGCPEDVPLCSYDH
FKQMYADRIEQCDLSAMCYEPHVPSSEKDEL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgctacttcgcactggacccaatattgttttactccttgcgctacttgtaagcttctcc
tccatcctgctgtcgtcctccgtcggtgctgaaagatggtgtgcaaataatcccaaagat
accatattccgccggcttggtaccaaaactccgtaccgccacgtacagaacaaggatgta
cgcagcatagcaaccgtgaacggctgcaccgtcagcaagatatggggcctgtttcgccac
ggtacgcgaaacccatcgaaaagtatcatcgatcacatgcgtaccacacttccggaactg
cagcgggacatactggaacatggacatatatgccgggatcagctagagctgttcgaacgc
tggcagccccgggttacagtcgaagacgcaaagctactcgtgcgcgaaggaggcgacgaa
ctgttccagctaggacaaaggatacgtaaacggttcgggacgcacattccggaacggtat
gatgaacatgatttccggttcaagttcaccaaaaccgaacgtgcagagtatagtgctcgg
aattttagccacggtcttttcggccgtgacgaaccgatccaatatccggaggcactacat
cgcgacccggtgctacggttttacaagggttgcgagaaatggaagaagcaggtgaagcaa
aatccatactcgtaccgcgagatggaccgttttggtagctccaagcaaatgagaagcgtg
attgagaaactgtcgaaacgaatcggaacgttcgtcagcccggaagaggtacacgccatt
tatcagacgtgtgcgtttgaaacggcctggagcgatcgggacatctcaccgtggtgtttg
ctgttcgacaaggagagcatttccacgatggaatacaacgaagatctaaagtactactgg
atcgatggatatggttatgatttaacgcatcggcaggcatgttccgcttttgccgatctg
ttcaccaatttcaacgacgagaatggacctcgttttacgttctactttacacattcgggt
acgcttcttaaatcgatcgcctttttgaatctctacaaagacaacgaaccgctgaggggg
gaaaacatgcgtcacaagcgaaagtggcgcgtcagccacatcgatgcgttcggaaccaat
ctttactttgtgctgtatggttgccctgatggaacacaatcgatcgcattataccaccaa
gagaggcttaccaatataccaggctgcccggaagatgtaccgctttgcagttacgatcat
tttaaacaaatgtacgccgaccgtattgaacagtgtgatttgagtgcgatgtgttacgag
ccgcatgtgcctagcagtgaaaaggacgaattatga

DBGET integrated database retrieval system