KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003588
Entry
AgaP_AGAP003588   CDS       T01036                                 

Definition
(RefSeq) AGAP003588-PA
  KO
K02153  V-type H+-transporting ATPase subunit e
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00190  Oxidative phosphorylation
aga01100  Metabolic pathways
aga04145  Phagosome
Module
aga_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AgaP_AGAP003588
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    AgaP_AGAP003588
SSDB
Motif
Pfam: ATP_synt_H DUF4914
Other DBs
NCBI-GeneID: 1274252
NCBI-ProteinID: XP_313344
VectorBase: AGAP003588
UniProt: Q7QAP9
Position
2R
AA seq 95 aa
MGASALPIIIFSAIFGVVGIVLPIVAPKGPNRGIVQCVLILTAATCWLFWLCCYMAQMNP
LIGPKLHQNTILIMAREWGNPLPDMEGFQPEHSDH
NT seq 288 nt   +upstreamnt  +downstreamnt
atgggtgcttcagcgctgccaattatcattttctccgccatctttggcgtggttggcatt
gtcctgccgattgttgctccgaagggcccgaaccgtggaatcgtccagtgtgtgctgata
ttgacggcggcgacatgctggttgttctggctgtgttgctacatggcccagatgaacccg
ctgattggaccgaagctgcaccagaacacaattctcattatggcacgtgagtggggcaac
ccgctgccagacatggaagggttccagccagagcactcggatcactag

DBGET integrated database retrieval system