KEGG   Anopheles gambiae (mosquito): AgaP_AGAP003912Help
Entry
AgaP_AGAP003912   CDS       T01036                                 

Definition
(RefSeq) AGAP003912-PA
  KO
K11252  histone H2B
Organism
aga  Anopheles gambiae (mosquito)
Brite
Chromosome and associated proteins [BR:aga03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    AgaP_AGAP003912
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AgaP_AGAP003912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 1278747
NCBI-ProteinID: XP_318364
VectorBase: AGAP003912
UniProt: Q7Q2C5
Position
2R
AA seq 91 aa AA seqDB search
YAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAALLASRLAHYNKRSTITSREI
QTAVRLLLPGELAKHAVSEGTKAATKYTSSK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
tacgctatttacatctacaaagtgttgaagcaagtccacccggatactggcatctcttcg
aaggccatgagcatcatgaacagtttcgtcaacgatatcttcgaacgcattgctgctgca
ttgctggcatcccgcttggcgcactacaacaagcgttccacgatcacgtcccgcgaaatc
caaactgctgttcgtctgctgctgcctggtgagcttgccaagcacgccgtctccgaagga
acgaaggctgccacaaagtacaccagctcgaagtaa

DBGET integrated database retrieval system