KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004078Help
Entry
AgaP_AGAP004078   CDS       T01036                                 

Definition
(RefSeq) AGAP004078-PB
  KO
K03163  DNA topoisomerase I [EC:5.99.1.2]
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aga03032]
    AgaP_AGAP004078
DNA replication proteins [BR:aga03032]
 Eukaryotic Type
  DNA Topoisomerases
   AgaP_AGAP004078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Topoisom_I Topoisom_I_N Topo_C_assoc FapA TcdB_N UPF0242 DUF4706 DUF4194 Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 1270877
NCBI-ProteinID: XP_003436707
VectorBase: AGAP004078
UniProt: F5HJ60
Position
2R
AA seq 581 aa AA seqDB search
MAIPGFFSTTVQTSLHRVPKRLHLTNRWEEEKRDDGVKWKYLEHKGPVFAPPYDPLPSHV
KFMYDGKEMKLSQDAEEVAGFYARMLEHDYTSKQAFNDNFFKDWRKTMTPHERERITDLE
KCNFRPMAAYFAEIAEQNRNRSKEEKAALKAANEQLTKEYGICVIDGHKEKIGNFKIEPP
GLFRGRGEHPKMGLVKRRVMPEDVIINCSQDSKIPSPPPGRRWKEVRHDNTVSWLASWVE
NVQGQVKYIMLNPSSKLKGEKDWQKYETARRLLKHIDKIRDTYRDEWKSKEMRIRQRAVA
MYFIDKLALRAGNEKDDDQADTVGCCSLRYEHIALHKELNGKENVVVFDFLGKDSIRYYN
EVEVEKRVFKNLELFKENKKPGDDLFDRLNTSVVNEYLKGLMDGLTAKVFRTFNASYTLQ
KQLEELTDPNMSVPEKLLAYNRANRAVAILCNHQRAVPKTHEKSMGNLKEKIRVKREQVE
QCQKEFKDLKKSNVRDPSAFDKKSKQLERLKEQLKKLELQETDRDENKTIALGTSKLNYL
DPRISVAWCKKFGVPIEKIFNKTQRDKFRWAIDMADENYVF
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggcgattcccggcttcttttccacaacagtgcaaacctcattgcaccgggtgccaaaa
cgtttacatttaacgaataggtgggaggaggaaaagcgcgacgacggcgtcaaatggaag
tatttggagcacaaggggcctgtatttgcaccaccgtacgatccacttccttcgcacgtg
aagttcatgtacgatggcaaagaaatgaagctctcgcaggatgcggaggaagtggcaggc
ttctacgcgcgcatgctggaacacgactacacatccaagcaagcgttcaatgacaacttc
ttcaaggattggcgcaaaacgatgacgccccacgagcgggagcgcatcaccgacttggaa
aagtgtaacttccgtcctatggcagcgtacttcgcggaaatagccgagcagaaccggaat
cgcagcaaagaggagaaggctgcactgaaggcggcgaacgagcagctgacgaaggagtac
ggcatttgcgttatcgatgggcataaggaaaagattggaaacttcaaaatagaaccgccc
ggtttgttccgcggccgtggcgagcatccgaagatgggcctggtgaagaggcgcgttatg
cccgaggacgtcatcatcaattgctcgcaggacagcaaaataccgtccccaccgccaggt
cgccgatggaaggaggtacgccacgacaacactgtatcgtggctagcttcctgggtcgaa
aatgtgcaggggcaggtgaagtacatcatgctgaatcccagctccaagctgaagggcgaa
aaggattggcagaagtacgaaacggcgcgtcggttgctgaagcacatcgataaaattcga
gacacgtaccgcgacgagtggaagagcaaggagatgcgtatccgacagcgcgcggtagcg
atgtactttatcgataagcttgcgctgagagcgggcaatgaaaaggatgacgatcaggcc
gatacggtcggttgctgttcgctgcgttacgagcacatagcgttgcacaaggagctgaac
ggtaaagagaacgtggttgtgttcgatttcctcggtaaggattccatccgctactacaat
gaggtggaggtggagaagcgtgtcttcaagaacttggagctgtttaaagaaaacaaaaag
ccgggcgacgatctgtttgaccggttaaatacgtccgtagtgaacgaatatctgaaggga
ttgatggatgggctcactgccaaagtgttccgtactttcaacgcatcttacacattgcaa
aagcagttggaagaattgacggatcctaacatgtccgtaccggaaaagctgcttgcttac
aatcgtgcaaatcgtgcggtcgcaattttgtgtaaccatcagcgggccgtcccgaaaacg
cacgagaaaagtatgggcaatctgaaggaaaagattcgcgtgaagcgcgaacaggttgaa
cagtgtcaaaaggaattcaaggatctcaagaaaagtaatgttcgtgatccgagcgcgttt
gacaagaagagcaaacagttggaaaggctaaaggagcaactgaagaagttggagctccag
gaaacggatagggatgaaaataaaacgatcgctctgggcacatccaagctgaactatctg
gatccccgtatctccgtggcttggtgtaagaagttcggagtaccgattgagaagattttc
aacaagacacagcgtgacaaattccgatgggcaatagatatggccgacgaaaactacgta
ttttaa

DBGET integrated database retrieval system