KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004366
Entry
AgaP_AGAP004366   CDS       T01036                                 

Definition
(RefSeq) AGAP004366-PA
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00250  Alanine, aspartate and glutamate metabolism
aga00330  Arginine and proline metabolism
aga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AgaP_AGAP004366
   00330 Arginine and proline metabolism
    AgaP_AGAP004366
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     AgaP_AGAP004366
SSDB
Motif
Pfam: Aldedh DUF5913 SidC_N
Other DBs
NCBI-GeneID: 1274512
NCBI-ProteinID: XP_313649
VectorBase: AGAP004366
UniProt: Q7QA89
Position
2R
AA seq 573 aa
MFTVCKSAAGTTLVASLQRYGVRAMSSSVVHAPKLAEFPLENEPILGYRKGSKERKELES
ALKKAASKMEDVPIVIGSEEIRSKEVRHQVMPHNHKHKLAQFYYADQKLLQKAIKTATET
QVKWDRTPLDERIRIWQKAADLMAGPYRQELNAATMLGQAKTVIQAEIDSAAELIDFIRM
NTYYLKEAAKYQPISEDAKVTKNSMRFRGIDGFIAAVSPFNFTAIGGNLAYTPALMGNGV
LWKPSDTALLSNYVIFKIMREAGVPPGVVNFVPTDGPVFGDTITASPHLAGINFTGSVPT
FNRLWRQVGENINSYNNFPRLIGECGGKNYHFVHPSADVESVVNGTIRSAFEFCGQKCSA
CSRMYVPESLWPKVKDGLLMIRDTLKVGDVTDFSNFTSAVIDDKAFARIKSYIEHARSSK
NLTILGGGKCDDSKGYFIEPTIVQTTDPTDRIMTEEIFGPVLTIYVYKDKDLDSAMKLVG
GSTRFALTGAVFAQDQAFLKRALEEFKMTAGNFYLNDKSTGSVVGQQPFGGGRMSGTNDK
AGGPHYVLRWATPQSIKETFVPLKDIDYPYMRE
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgttcaccgtttgcaagagtgcggcagggacaacgctggtcgccagcctgcaaaggtat
ggcgtccgcgcaatgtcgtcgtcggtggtgcatgcccccaagctggccgaattcccgctg
gagaatgaacctattctcggctaccgcaaagggtcgaaggaacgcaaagagctggaaagt
gcgctgaagaaagccgcctccaagatggaagacgtgccgatcgtcatcggctcggaagag
atacgctcgaaggaggtgcgtcaccaggtaatgccacacaaccacaaacacaagctggcc
cagttctactacgcggatcaaaagctgctgcagaaggcgatcaagacggccacggaaacg
caggtgaagtgggaccgcaccccgctcgatgagcgcattcgcatctggcagaaggcggcc
gatctgatggccggtccgtaccgccaggagctgaacgcagccaccatgctcgggcaggcg
aagaccgtgatccaggcggagattgattccgccgccgagctgatcgatttcatccgcatg
aacacgtactacctaaaggaggcggccaaatatcagccgattagcgaggatgcgaaggtg
acgaaaaattcgatgcgattccgtggcatcgatgggttcatcgctgccgtcagtccgttc
aatttcactgccatcggcggcaatctggcatacacgcccgccctcatgggtaacggtgtg
ctgtggaagccgtccgacactgccctgctctccaactacgtcattttcaagatcatgcgt
gaggctggcgtaccaccgggtgtggtaaacttcgtgcccactgatggtcccgtctttggc
gatacgatcacagcctcaccgcatctggccggtatcaactttaccggatcagtaccaacg
ttcaaccggttgtggcgccaggtgggcgagaacattaacagctacaacaatttcccccga
ctgattggcgagtgcggcggcaagaactaccactttgtgcatccgtccgcggatgtggag
tcggtggtgaacggcacgatccggtccgcgttcgagttttgcggccagaagtgttcggcc
tgttcgcgtatgtacgtgcccgagtcgctgtggccgaaggtgaaggacgggctgctgatg
atccgcgacacgctcaaggtgggcgacgtgaccgacttttccaacttcacttcggccgtc
atcgacgacaaagcatttgcgcgtatcaaatcgtatatcgagcacgcccgcagctccaaa
aatctgaccattctcggcggtggcaagtgcgacgacagcaagggttacttcatcgagccg
accattgtgcagaccacggacccgaccgatcgcatcatgacggaggaaatctttggcccg
gtgctcacgatctacgtgtacaaggataaggatctcgacagtgcgatgaagctggtcggt
ggctcgacccggttcgcactgaccggtgccgtgtttgcgcaggatcaagcattcctcaaa
cgagcactcgaagagttcaagatgacagccggtaacttctacctgaacgacaaatcaacc
ggttcggtggtcggccagcagccgttcggcggtggccgtatgtccggcacgaacgacaag
gccggcggaccacactacgtgctgcggtgggccactccgcaatcgatcaaggaaacgttc
gtcccgctgaaggacatcgattatccgtacatgcgtgaataa

DBGET integrated database retrieval system