KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004476
Entry
AgaP_AGAP004476   CDS       T01036                                 

Definition
(RefSeq) AGAP004476-PA
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aga02000]
    AgaP_AGAP004476
Transporters [BR:aga02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   AgaP_AGAP004476
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    AgaP_AGAP004476
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 1274624
NCBI-ProteinID: XP_313775
VectorBase: AGAP004476
UniProt: Q7QA16
Position
2R
AA seq 512 aa
MQATVSEGNGQGPNSSSSSTGHNHSSSPKLPPPGSWASLKANVIRWRGSRKLVLVIVAIA
LLLDNMLLTVVVPIIPEFLYDIRHPDAPLASFPKTPPTTPCEKEVTTPYNGIDVTTQGYD
NASWYAEREERHKELVEETVEVGLMFASKAFVQLLANPIVGPLTHKIGYSIPMFAGFVIM
FISTLIFAFGRTYSVLFLARALQGIGSSCSSVSGMGMLADRYTDDKERGNAMGIALGGLA
LGVLIGPPFGGIMYEFVGKSAPFLVLSALALGDGLLQLIMLQPSVVIEESDPPSLKALVT
DPYIIIAAGAITFANMGIAMLEPSLPIWMMDNMGASRWEQGVTFLPASISYLIGTNLFGP
LGHRIGRWLAALLGLVIIGLCLLCIPMATSINHLILPNAGLGFAIGMVDSCMMPELGYLV
DIRHSAVYGSVYAIGDVAFCLGFAIGPALSGTLVNTIGFEWMLVGISILCFAYAPLLTFL
RAPPTKEEKKSLIVGERSSVRYVTYQNEEEDE
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgcaagcaacggtctcggagggaaacggtcagggacccaacagcagtagcagcagcacc
ggccacaatcacagctcttctccgaaactgccgccacccggctcgtgggcatcgctgaag
gcaaacgtgataagatggcgcggctcacggaaactggtactcgtcatcgtcgccatcgca
ctcctgctcgacaatatgctgctgaccgtcgttgtgccaatcattccggagtttctttac
gacatcagacacccggatgcaccgctggccagctttcccaagactccgccgaccacaccg
tgcgagaaggaggtgacgacaccgtacaatggcatcgacgttacaacgcaaggttacgat
aatgctagctggtacgcggaacgggaggaacggcacaaggagctggtggaggaaacggtc
gaggttgggcttatgtttgcctcgaaagcattcgtccagttgctggccaatcccatcgtg
ggaccgttgacacacaaaataggctacagcattccgatgtttgccgggttcgtcattatg
tttatctccaccctgattttcgcattcggaagaacgtactcggtactgttcctggctcgc
gcactgcagggtatcggatcgtcctgttcgtcggtgtccggcatgggcatgctggccgat
cgctacacggacgacaaggagcgggggaacgcgatgggcatcgcgctcggtggactggcg
ctcggtgtactgatcgggccaccgttcggtggcatcatgtacgagtttgtgggtaaatcg
gcaccgtttctggtcctgtcggcgctggcactgggcgatgggctgctgcagctgatcatg
cttcagccgtccgtcgtgatcgaggagtcggacccgccgtcgctgaaggcgctcgtcacc
gatccgtacatcatcattgcggccggtgcgatcacgtttgcgaacatgggcattgcgatg
ctggaaccgtcgctgccgatctggatgatggacaacatgggtgcgagccgatgggagcaa
ggcgtcacctttctgcccgcctcgatcagctacctgatcgggacgaatctgttcggtccg
ctggggcaccgtattggccggtggctggcggcgctgctggggctggttattatcgggctg
tgcttgctgtgtattccgatggctacctccatcaaccatctgattttgccgaatgcgggg
ctcggattcgctatcggcatggtcgattcttgcatgatgcccgaactcggctacctggtg
gacattcgacattcggctgtgtacggcagtgtgtacgccatcggagacgttgcgttctgt
ttgggtttcgccatcggtccagccctaagtggcaccttggtaaacaccatcggcttcgag
tggatgctggttggaatttcgatcctttgcttcgcttacgcaccgctgctgacgttcctg
cgagcaccgccgaccaaggaggagaagaagtccctcatcgtcggagagcgctcgtcggta
cgttacgtcacgtaccaaaatgaggaagaggacgaataa

DBGET integrated database retrieval system