KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004564Help
Entry
AgaP_AGAP004564   CDS       T01036                                 

Definition
(RefSeq) AGAP004564-PA
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00230  Purine metabolism
aga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AgaP_AGAP004564
Enzymes [BR:aga01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     AgaP_AGAP004564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA HNOB Guanylate_cyc
Motif
Other DBs
NCBI-GeneID: 1274705
NCBI-ProteinID: XP_313866
VectorBase: AGAP004564
UniProt: Q7Q9W6
Position
2R
AA seq 649 aa AA seqDB search
MYGMLLESVQHFVQLEYGEFVWRQALLTTGCKNTVFNTHQLYPDNLIPDLAAALSAITGK
PFDEFMIFFGRCFVRFFSNFGYDELIKATGRYFCDFLHSVDNIHLQMRFTYRKMKSPSMQ
LTEVDENGAVLVYRSTRTGFSKYLRGQLLEIAKQLYGMDVSIKVLESQNDTPGGTSGPIA
PQGGLKTVIVKYRLDFDNREYMQRRVHIKAHPSQLQLTPVNSKLLLNLFPFALILNEEMK
ITAVGEKLIESWMLNNVNRSPTELLGAKVTDHFKLRRPSGITFTWENIKRLQTVLFEIQL
LKGSSAKGTKDESKIVDTKTSLSQVDTSSSTEDAAKIMTSIPRRGSQGLRSILLKGEMRY
IKDINSLVFLCSPLINNLEELREMGLYLNDLNPHGLSREMVFSGFSHYSRLDLMCEREEQ
RAEELETSLALADSWKRQGDELLYSMIPRSIAERLREGQNPHETCQSFEEVTVLFAEVQE
TITGDDSIKYAMTTVNTLNAAFSAFDELIHSPMAYKVETVGKVYMAVSGAPDINPFHAQH
MADLALDMLHSIRQLNLPGVGVKIGFHSGPIVAGIVGLKVPRYCLFGDTVNTASRMESSG
ETDCIQVSGYTAQKLKKLGYVLAYRGKVAVKGKGDMETFWLQGPPQKKK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtacggaatgctactggagagtgttcaacattttgtacagttggagtatggagaattc
gtttggcgtcaggccctactcacaacgggatgtaaaaatacagtattcaacacacaccag
ctttacccggataatttgatacctgaccttgcagcagcactttcggctataacaggaaaa
ccgttcgatgagtttatgatatttttcggacgatgtttcgttcgattctttagtaatttc
ggttatgatgagttgatcaaggcaacaggtcgctatttctgcgattttctacattcagtg
gataacattcacctgcagatgcgcttcacttatcgcaagatgaaaagcccatctatgcag
ctgacggaagtagatgaaaatggtgccgtactggtgtacagaagcacacggaccggattc
tcgaagtatcttcgagggcagcttttggaaatagccaagcagttgtacgggatggacgtc
agcatcaaggtactggaaagccagaacgatactcctggtggtacatcgggaccaattgca
ccacaaggcggcttgaagacggttatcgtgaagtatcggttggattttgacaatcgtgaa
tatatgcagcggcgtgttcatatcaaagcacatccatcacagctacagttgacaccggtg
aacagtaaactgttgctgaatttattcccattcgctctaatcctgaacgaggaaatgaaa
attactgccgtgggcgagaaactcatcgagtcttggatgctgaacaatgtgaatcgatca
cctacggaactgctcggggcaaaagtaactgatcatttcaagcttcgtcgtccgagcggt
ataacgttcacctgggaaaatattaaacggctgcaaactgttttatttgagatacagctc
ctaaaaggctcttctgcaaaaggcacaaaagacgagtcgaaaatagtcgacactaaaaca
tcattatcgcaggtggatacgagctcctcgacagaagatgcggccaagataatgacctct
attccacggcggggctctcaagggcttcgcagcattttgttgaaaggtgaaatgcgttac
atcaaagacataaattcccttgtatttctatgcagtcccctcatcaacaacttggaagag
ttacgtgaaatgggactgtacctaaacgatctcaaccctcacgggcttagccgcgagatg
gtgttttctggattttcacactattcccggctcgatttgatgtgtgaacgcgaggagcaa
cgggctgaggaactagaaacatcgcttgccctcgctgactcctggaaacggcaaggtgat
gagctgctgtactcaatgattcctcgctcgatagcggaacggttgcgtgagggtcagaat
cctcacgagacctgtcagagcttcgaggaagtgacggtactgttcgccgaggtacaggaa
acgatcactggtgatgattcgatcaagtacgccatgaccacggtaaacacactgaacgct
gctttcagtgcgtttgatgagttgatccattcaccgatggcctataaagtggagaccgtt
ggaaaggtgtacatggcggtgagtggagctccggacataaatccatttcatgcgcagcac
atggctgatctggcattagatatgctacacagtatacggcagcttaatctacctggagta
ggagtcaaaataggctttcactctgggccaatagtggccggaatcgtgggattgaaggta
ccgaggtattgtcttttcggtgacacggtaaatacggcttcgcggatggaaagtagcgga
gagacggattgcatccaggtgtctggatacactgcacaaaagctcaaaaagcttggatat
gtactggcgtatcgtggaaaggtagccgtcaagggtaaaggagacatggagacgttctgg
ctacaaggaccgccgcaaaaaaagaaataa

DBGET integrated database retrieval system