KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004583Help
Entry
AgaP_AGAP004583   CDS       T01036                                 

Definition
(RefSeq) AGAP004583-PA
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga03040  Spliceosome
aga04141  Protein processing in endoplasmic reticulum
aga04144  Endocytosis
aga04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:aga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    AgaP_AGAP004583
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AgaP_AGAP004583
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AgaP_AGAP004583
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    AgaP_AGAP004583
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aga01009]
    AgaP_AGAP004583
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aga03041]
    AgaP_AGAP004583
   03009 Ribosome biogenesis [BR:aga03009]
    AgaP_AGAP004583
   03110 Chaperones and folding catalysts [BR:aga03110]
    AgaP_AGAP004583
   04131 Membrane trafficking [BR:aga04131]
    AgaP_AGAP004583
   03051 Proteasome [BR:aga03051]
    AgaP_AGAP004583
   03029 Mitochondrial biogenesis [BR:aga03029]
    AgaP_AGAP004583
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aga04147]
    AgaP_AGAP004583
Protein phosphatases and associated proteins [BR:aga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     AgaP_AGAP004583
Spliceosome [BR:aga03041]
 Complex B
  Other components
   Prp19 complex
    AgaP_AGAP004583
 Complex C
   Prp19-CDC5 complex
    AgaP_AGAP004583
Ribosome biogenesis [BR:aga03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    AgaP_AGAP004583
Chaperones and folding catalysts [BR:aga03110]
 Heat shock proteins
  HSP70 / DNAK
   AgaP_AGAP004583
Membrane trafficking [BR:aga04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    AgaP_AGAP004583
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    AgaP_AGAP004583
Proteasome [BR:aga03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    AgaP_AGAP004583
Mitochondrial biogenesis [BR:aga03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    AgaP_AGAP004583
Exosome [BR:aga04147]
 Exosomal proteins
  Proteins found in most exosomes
   AgaP_AGAP004583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A StbA
Motif
Other DBs
NCBI-GeneID: 5667608
NCBI-ProteinID: XP_001688624
VectorBase: AGAP004583
UniProt: A7UTJ9
Position
2R
AA seq 420 aa AA seqDB search
MPSAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTERLIGDAAKNQVAMN
PTNTVFDAKRLIGRRYDDPKIQADIKHWPFKVVNDCGKPKIQVEFKGERKTFAPEEVSSM
VLTKMKETAEAYLGHSVKNAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALA
YGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRMVGHF
VEEFKRKFKKDVSKNARALRRLRTACERAKRTLSSSTEATIEIDALMDGIDYYTKISRAR
FEELCSDLFRSTLQPVEKALSDAKMDKSSIHDIVLVGGSTRIPKVQSLLQNFFCGKSLNL
SINPDEAVAYGAAVQAAILSGDKDEKIQDVLLVDVAPLSLGIETAGGVMTKLIERNSRIP
NT seq 1259 nt NT seq  +upstreamnt  +downstreamnt
atgccttctgcaattggaatcgatctgggcacgacctattcgtgcgtgggagtgtttcag
cacggcaaggtggagattattgccaacgaccagggcaacagaaccacaccgagctatgtt
gcgttttcggacacggagcgcctcatcggtgacgcggccaagaaccaggtggccatgaac
cccacaaatacagtgttcgatgccaagcgactgatcggacgccggtatgacgaccctaag
attcaggccgatatcaagcactggccgttcaaggtggtcaacgactgcggcaagccgaag
attcaggtggaattcaaaggagaacgcaagacgtttgcaccagaggaagtcagctcgatg
gtgctgacgaaaatgaaggaaacggccgaagcatacctgggacactctgtgaagaatgcg
gtcatcacggttccagcgtacttcaatgacagccagcgacaggccacgaaggatgccggt
gcgatcgcgggcctgaatgtgatgcgaatcatcaacgaaccgacggcggccgcattggct
tacggtttggacaagaacctgaagggcgagcgcaacgtgttgatcttcgatctcggcgga
ggaacgttcgacgtgtccattttgacgatcgacgagggctctctgttcgaggtacgagcc
actgccggtgacacacacctgggaggcgaagacttcgacaaccgaatggtgggccatttc
gtggaggagttcaaacgcaagttcaagaaggacgtgtccaagaacgccagagcactgcga
cgcttgaggacggcatgcgagcgagcgaagcggacgctttcgtccagcacggaggccacg
atcgagatcgatgccctcatggacggaatcgactactacacaaagatcagccgagcacga
ttcgaggagctgtgctctgatctgttccgctcgacactgcaaccggtggagaaggccctg
tcggatgcaaagatggacaagagctccattcacgacatcgtgctggtaggtggatcgacc
cgcatcccgaaggtgcagtcgctgttgcagaacttcttctgcggcaaatcgctgaacctg
tcgatcaacccggatgaggcggtagcatacggtgcggccgtccaggcggctattcttagt
ggagacaaggacgaaaagatccaagatgtattgttggtcgatgtggctccgttgtcgctc
ggaatcgaaacggccggcggagtgatgacgaagctgatcgagcgaaattcgcgcattcc

DBGET integrated database retrieval system