KEGG   Anopheles gambiae (mosquito): AgaP_AGAP004786
Entry
AgaP_AGAP004786   CDS       T01036                                 

Name
(RefSeq) AGAP004786-PA
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00010  Glycolysis / Gluconeogenesis
aga00020  Citrate cycle (TCA cycle)
aga00620  Pyruvate metabolism
aga01100  Metabolic pathways
aga01200  Carbon metabolism
Module
aga_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AgaP_AGAP004786
   00020 Citrate cycle (TCA cycle)
    AgaP_AGAP004786
   00620 Pyruvate metabolism
    AgaP_AGAP004786
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     AgaP_AGAP004786
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N
Other DBs
NCBI-GeneID: 1278437
NCBI-ProteinID: XP_318026
VectorBase: AGAP004786
UniProt: Q7Q2S3
Position
2L:3545835..3548422
AA seq 397 aa
MLSNVAKSIGQRNLFGKLKPLSSQQQNGFASEATFETRAFKLHNLEEGPSTKVTLTKEDA
LKYYGQMYTIRRMETAAGNLYKEKVIRGFCHLYSGQEACAVGMRAAMRPEDSCITAYRCH
GWTYLMGVSPVGVLAELTGRSSGCARGKGGSMHMYGKNFYGGNGIVGAQVPLGVGIGFAA
KYNGTQGACIALYGDGAANQGQLFEVYNMAKLWNAPCIFVCENNGYGMGTSAERASANTN
YYTRGDFVPGIWVDGMDVLAVREATRFALEHTSSGKGPILMETATYRYSGHSMSDPGTSY
RSRDEIAEVRQTRDPITSLREKILTTELATVEELKEIEGKIRAEVDSATKVAKTDKEISV
DELTADIYANPENLTSVRNTVPHAELQHKRLGQAVNM
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgctttcgaacgtagcaaaatcgattggccagcgcaatctgtttggcaagttgaaacca
ctttcaagccagcagcagaatggatttgcttcggaagctacgttcgagacgcgggccttt
aagctgcataaccttgaagaaggaccttcgaccaaggtgacactcaccaaggaggatgct
ctgaaatactacggccagatgtacacgataagacgcatggaaacggctgccggtaacctg
tacaaggaaaaggtgatcagaggcttttgtcatctgtactctggccaggaggcgtgtgcc
gttggaatgcgtgcggctatgcgtcccgaggattcctgtatcaccgcgtaccggtgccac
ggatggacgtatctgatgggtgtgtctcccgtgggcgtactggctgagctaacgggccgt
agcagcggctgcgctcgaggtaagggtggcagcatgcacatgtacggtaagaacttctac
ggcggaaatggcatcgtcggagctcaagtaccactaggtgtcggtatcggcttcgctgct
aaatacaacggaacccagggagcctgcattgcgctgtatggcgatggagctgccaaccag
ggtcagctgtttgaggtgtacaacatggcaaagctgtggaacgcgccttgcatattcgtc
tgcgagaacaatggttacggaatgggtaccagcgctgagcgtgcgtctgccaacaccaac
tactatactcgtggagactttgtgcccggtatctgggtcgacggtatggacgtgttggca
gttcgcgaagccactcgcttcgcgttggaacacacctcctccggcaagggaccaattctg
atggaaacggccacttaccgttactctggacattccatgtccgaccccggcactagctat
cgctcgcgcgacgaaatcgccgaagtaagacaaactcgagatccgataacatcgctacgc
gaaaagattttaacgaccgagctggccacggtggaagagctgaaggagattgaaggcaag
attcgtgctgaggtagactcggcgacaaaggtggccaagaccgacaaagaaatctccgtc
gatgagcttaccgcagatatttatgccaatccagaaaacctcacgtccgtacgcaacaca
gtgccccatgccgaactgcagcacaagcggcttggacaggcggtcaacatgtaa

DBGET integrated database retrieval system