KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP005080
Entry
AgaP_AGAP005080   CDS       T01036                                 
Name
(RefSeq) AGAP005080-PA
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00030  Pentose phosphate pathway
aga00040  Pentose and glucuronate interconversions
aga01100  Metabolic pathways
aga01200  Carbon metabolism
aga01230  Biosynthesis of amino acids
Module
aga_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
aga_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AgaP_AGAP005080
   00040 Pentose and glucuronate interconversions
    AgaP_AGAP005080
Enzymes [BR:aga01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     AgaP_AGAP005080
SSDB
Motif
Pfam: Ribul_P_3_epim QRPTase_C ThiG PG_binding_3 OMPdecase IGPS
Other DBs
NCBI-GeneID: 1274761
NCBI-ProteinID: XP_313959
VectorBase: AGAP005080
UniProt: Q7Q9R5
Position
2L
AA seq 228 aa
MAPLSARIGPSILNADLSQLHEESEKLLANGADYLHLDVMDGTFVPNLTFGHPVVKCLRN
KIKDAFFETHMMVQNPQQWIEPMADAGVQQYTFHIEPVLDSVADVCRKVRESGMKVGLAL
KPGTAVEAVQQYIDSADMVLVMTVEPGFGGQKFMGDMMPKVQWLREHYPALDIEVDGGVG
PATIEQCSKAGANMIVAGTAIIRADDQAAVIRDLRSAVQSAINHGGQC
NT seq 687 nt   +upstreamnt  +downstreamnt
atggccccactcagtgctcgcattggcccatcgattcttaatgccgatctttcccagctg
cacgaggagtcggagaagctgctcgcaaacggtgccgactatctgcacctggacgtgatg
gacggtaccttcgtgccgaacctcacctttggccatccggtggtgaagtgtttgcgaaac
aaaatcaaggatgcatttttcgagacgcacatgatggtgcagaatccccagcagtggatt
gaaccgatggccgatgccggtgtacagcagtacacattccacatcgaaccggtcctcgat
agcgtggcggacgtctgcaggaaggtgcgcgagtctggcatgaaggttgggctggcgctc
aaaccgggaacagcggtggaagcggtccagcagtacattgatagtgcggacatggtgctg
gtgatgacggtggagcccggcttcggggggcaaaagtttatgggcgatatgatgccgaag
gtccagtggctaagggagcactaccctgccctagacattgaggtggacggtggtgttggg
ccggccacgattgagcagtgctcgaaggcgggtgccaatatgatcgtggccgggactgcg
atcatacgggccgacgatcaggcggcagtgattcgcgatttgcgaagtgccgtgcagagt
gctattaatcatggaggacaatgctaa

DBGET integrated database retrieval system