KEGG   Anopheles gambiae (mosquito): AgaP_AGAP005490
Entry
AgaP_AGAP005490   CDS       T01036                                 

Definition
(RefSeq) AGAP005490-PA
  KO
K04860  voltage-dependent calcium channel alpha-2/delta-3
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:aga04040]
    AgaP_AGAP005490
Ion channels [BR:aga04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   AgaP_AGAP005490
SSDB
Motif
Pfam: VWA_N VGCC_alpha2 dCache_1 VWA_2 VWA VWA_3 VWA_CoxE dCache_3 dCache_2 MKT1_N
Other DBs
NCBI-GeneID: 1276178
NCBI-ProteinID: XP_315491
VectorBase: AGAP005490
UniProt: Q7Q758
Position
2L
AA seq 1239 aa
MLYTGGRSSCGILAFTFLLFFAISITRSADEPTTTIKYNVVQAWAAKLGGELWHLGDFIT
RRKEVEESFKQAQVVNKNGAKIVEEMAKDLKYMMDAKVSAVKRIMDTAENTAISFDEEPV
NQSFQYYNAKQMIEPGEIITTPIPMIDEDPADITTPIPPKEIVLTKKRHFFNEAVNTTVS
SVHVPTNVYDRATEVIKAIKWSEALDSIFYNNYIGDPTLTWQYFGSSSGFLRQFPATKWE
QDPVDLYDCRLRSWYIEAANSPKDMLILVDSSGSMTGQRKDIAKHVVSNILDTLGPNDYV
NIFTFSEEVAEVVPCFRDTLVQANMGNIRELKLGMDNIETNEIANVSAALTRAFELLEQF
RETRNGARCNQAIMLVSDGVPYSFDEVFEQFNWKELPFIPVRVFTYLIGREVADVKEIKE
MACRNQGYYVHLSTMAEVREEVLNYIPVIARPLVLNKREHPVVWSEIYADVEDPKMTDWL
WEIKERAEQKERFIDYRKNRVLFYSPEEQHRRMIMKQRMNQDPYSNTQKYNFMTTVSVPV
FDRRENATRVANILGVAGADVPIAEIKKYLKPHLLGVNGYAFIVTNNGYILTHPDFRPVF
QDILKPAYNTVDMIEVELTDDDQGPREFNNQLLNMRESIINQSTGAKWIRVKYHFDEMKR
VSRTKRQYYWTPIKNTPFTLVVTYPETYGLNRLQIRTEDEIHRIHAKGSNVASFFTGNNW
KIHPDWVYCKYLNEHPNETFATPELELKHFLERMKLGGWKWPSNRTPPPPEHAMFSNITG
KLPDKDYYYCDRGLMQALVYDAKVTEWFSKNVSGSGGNKDEKGNEFKQRFGITVSFLATH
SGLTRWQEYATGADESKQAEPDFSETHNRAIDEVWYKRAVELDRNSFVYSVPFDAGNRND
TLVTASHAIFHADGAREAPVAVVGFQFHHSALYTLFKNITSQCGHGDPRCEKTCFTGDYQ
CYVIDNNGFVVISEQLQETGAFFGEVKPAFMQRLLDDSIFRNVTVYDYQAVCFMAKGSIN
LGTVLQTPLRLLWWLLTNTFSYLVWVVMQLFLSLARAYDEMYDTGAYDVVPELGDLDDPT
LNRYKEPEFNKVLINRTRPEPCDHVITLYELNMDVDPSVYTKEAHQCERPYVVLPIPSSN
LLLLVLDTLCPLPTHVPQLSTWPVEHDYNASLACHKARSDPLPRRRPLTCINKHANESVI
ELCGDGSIPRLNVALLLALLAFGQCIGRRYTAGALFAYL
NT seq 3720 nt   +upstreamnt  +downstreamnt
atgttgtacacgggcggcagaagtagctgcgggatactagcgttcacgtttctgctgttc
tttgccatctcgattacccgcagtgccgatgagccgacgacaacaatcaagtacaacgtt
gtccaagcctgggcggccaaactgggcggtgagctgtggcatttgggggattttataacg
agaagaaaggaggtggaagagagttttaaacaagcgcaggtagttaacaaaaatggagca
aaaatcgtggaagagatggccaaggatctcaagtacatgatggatgcgaaagtgagcgcc
gtgaagcgcatcatggatacggcagagaacactgccatatcgttcgacgaggagccggtg
aaccaaagcttccagtactacaacgcgaagcagatgatcgagccaggcgaaatcatcacc
acgccgatcccgatgatcgacgaggatccggccgacattaccacgccgataccgccgaag
gagatcgtgctgacgaagaagcgccacttcttcaacgaggccgtcaacacgacggtcagc
tcggtgcacgtgccgacgaacgtgtacgaccgggcaaccgaggtgatcaaggcgatcaag
tggtccgaggcgctcgactccatcttctacaacaactacatcggcgacccgacgctgacg
tggcagtactttggcagctcgagcggcttcctgcgccagttcccggcgaccaagtgggag
caggacccggtcgacctgtacgactgccggctgcgctcctggtacatcgaggcggccaac
agcccgaaggacatgctgatcctcgtggacagctccggctcgatgacgggccagcggaag
gacattgccaagcacgtcgtctcgaacatcctcgacacgctcggaccgaacgactacgtc
aacattttcaccttctcggaagaggtggcggaagtggtgccgtgctttcgcgacacgctc
gtgcaggcgaacatgggcaacattcgcgagctgaagctcggtatggacaacatagagacc
aatgagatcgctaacgtttcagccgccctcacgagggcgttcgagctgctggaacagttc
cgggaaacccgcaacggggcccggtgtaaccaagcgatcatgttggtctcggatggtgtt
ccatacagcttcgacgaggtgttcgagcagtttaattggaaggagcttccgttcataccg
gtgcgcgtgtttacgtacctgatcgggcgcgaggtggcggacgtgaaggagatcaaggag
atggcgtgtcgcaatcagggctactacgtgcatctcagcacgatggcggaggtgcgggag
gaagtgctgaactatataccggtcattgcgcgaccgctggtgctgaacaagcgcgaacat
ccggtggtttggtcggagatatatgcggacgttgaggatcccaaaatgaccgactggcta
tgggagattaaggagcgagccgagcagaaggaacgcttcatcgattatcgcaaaaatcgg
gtgctgttctactcgccggaagagcaacatcggcgcatgatcatgaagcaacgcatgaac
caggacccgtactcgaacactcagaagtacaacttcatgacgaccgtctcggtgccggtg
tttgatcgccgagagaatgcgacgcgggtggccaacatactcggtgtggctggagccgat
gtgccaatagcggaaataaaaaaataccttaaacctcacctgcttggtgtaaatggatac
gccttcattgttaccaacaatggctacatcctcacgcatcctgacttccgtccagttttt
caagatattctcaagccagcctacaacacggtcgacatgatcgaggtcgagttgaccgat
gacgaccaagggccacgagagtttaacaaccaactgcttaacatgcgtgaatctatcatt
aatcagtcgactggagccaagtggatacgggtgaagtaccactttgatgagatgaaacgg
gtatcgcgtacgaagcgccagtactactggacaccgatcaagaacaccccgttcacgctg
gtggtcacgtatcccgagacgtacgggctcaatcggctgcagatacgcacggaggacgag
atccaccgtattcacgcgaaaggcagcaacgtggccagcttcttcaccggtaacaattgg
aaaatccatccggattgggtgtactgtaaatatttaaacgaacacccgaacgaaacgttc
gccacgccggagctggagctgaagcatttcctcgagcgcatgaagctcggtggctggaag
tggccgtcaaaccgcacaccgcccccaccggaacatgccatgttctctaatataacgggc
aaattgccagataaggactattattactgcgatcgcggtttgatgcaagcgctcgtctac
gacgcaaaggtaacggaatggttctcgaagaacgttagcgggagtggcggaaacaaggac
gagaaagggaacgagtttaagcagcgctttggcatcaccgtctcttttctggccacgcac
tcagggctaacgcgatggcaggagtacgccaccggtgcggacgaatcgaaacaagccgaa
cccgattttagcgaaacacacaaccgagcgatcgacgaggtgtggtacaagcgggcggta
gagctcgatcggaacagcttcgtctactcggtaccgttcgatgcgggcaaccggaacgac
acgctcgtcaccgccagccatgcgattttccacgcggacggggcgcgcgaagctccggtc
gcggtggtcggcttccagtttcaccactcggcgctgtacacgctgttcaagaacattacc
agccagtgcggccacggggatccgcggtgcgagaagacctgcttcaccggcgactaccag
tgctacgtgatcgacaacaacgggttcgtggtgatcagcgagcagctgcaggagacaggc
gccttcttcggcgaggtgaagcccgccttcatgcagcgcctgctggacgacagcatcttt
cgcaatgtgaccgtgtacgactaccaggcggtgtgcttcatggcgaagggttcgatcaat
ctcggcacggtactgcagacgccgctgcgattgctctggtggctgctgaccaacacgttc
tcgtacctggtgtgggtggtaatgcagctgtttctcagcctggcacgggcgtacgatgag
atgtacgacaccggagcgtatgacgtagtgcccgagctgggcgatctcgacgatccaacg
ctgaaccggtacaaggagcccgagtttaacaaggtgctgatcaaccgtacccgtcccgag
ccgtgcgatcacgtgatcacgctgtacgagctgaacatggacgtcgacccgtcggtgtac
acgaaggaggcccatcagtgcgaacgtccctacgtggtgctgccgattccgtccagcaat
ctgctgctgctcgtgctggacacgctctgcccactgcccacccacgtgccacagctgtcg
acgtggccggtggagcacgattacaatgcttcgctcgcctgccacaaagcccggagcgat
ccgctgccgcgtcgaaggccgctcacctgcatcaacaagcacgcgaatgaaagtgtgatt
gagctgtgcggtgacggtagcataccgaggctaaatgttgctttgctgcttgccctgcta
gcgttcggccagtgcatcgggcggcggtacactgccggtgccctcttcgcttacctctga

DBGET integrated database retrieval system