KEGG   Anopheles gambiae (mosquito): AgaP_AGAP005618Help
Entry
AgaP_AGAP005618   CDS       T01036                                 

Definition
(RefSeq) AGAP005618-PA
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00270  Cysteine and methionine metabolism
aga01100  Metabolic pathways
Module
aga_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AgaP_AGAP005618
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     AgaP_AGAP005618
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     AgaP_AGAP005618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1
Motif
Other DBs
NCBI-GeneID: 1276302
NCBI-ProteinID: XP_315627
VectorBase: AGAP005618
UniProt: Q7Q6X6
Position
2L
AA seq 183 aa AA seqDB search
MVRAWFMDNEPTDQRLEHQLDPPKFLTLDELFKSTGVEYFKINIPTYDTDGVLGKIRNDR
GYSYEDEITCSEACLPDYANKLKSFFTEHLHTDEEIRLVLDGSGYFDVRNGPDDAWVRIE
VVAGDLIIIPSGIYHRFTLDMKNYIKAKRYFVGEPVWLPYNRPADEMDCRKDYLKRLEAG
FAA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgtgcctggtttatggacaatgagccgaccgatcagcgtctggagcaccagctc
gatccgcccaagttcctgacgctggacgagctgttcaaaagcaccggggtggaatatttt
aagattaacattccaacgtacgatacggacggggtgctggggaagatccgcaacgatcgg
ggctactcctacgaggacgaaatcacctgctccgaggcgtgcttgcccgattacgccaac
aagctgaagtcgttcttcaccgagcatctgcacacggacgaggagatccggctggtgctg
gacggttccggttactttgacgtgcgcaatggtccggatgatgcatgggtacggatcgag
gtcgttgccggtgatttgatcattattcccagtggaatctatcatcgcttcacgctggac
atgaagaactacatcaaagccaagcgttactttgttggcgaaccggtctggctgccttac
aaccgcccagcagacgagatggactgtcgcaaggactatttgaagcggttggaagctggc
ttcgccgcctaa

DBGET integrated database retrieval system