KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP005630
Entry
AgaP_AGAP005630   CDS       T01036                                 
Name
(RefSeq) AGAP005630-PA
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aga00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AgaP_AGAP005630
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aga03019]
    AgaP_AGAP005630
   03009 Ribosome biogenesis [BR:aga03009]
    AgaP_AGAP005630
   04131 Membrane trafficking [BR:aga04131]
    AgaP_AGAP005630
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aga04147]
    AgaP_AGAP005630
Messenger RNA biogenesis [BR:aga03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     AgaP_AGAP005630
Ribosome biogenesis [BR:aga03009]
 Eukaryotic type
  Pre-60S particles
   Ribosome quality control complex
    AgaP_AGAP005630
Membrane trafficking [BR:aga04131]
 SNARE
  SNARE associated proteins
   Others
    AgaP_AGAP005630
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    AgaP_AGAP005630
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AgaP_AGAP005630
SSDB
Motif
Pfam: AAA AAA_lid_3 CDC48_N RuvB_N AAA_16 AAA_2 AAA_5 AAA_33 AAA_22 CDC48_2 TIP49 AAA_14 Vps4_C Mg_chelatase RNA_helicase AAA_18 AAA_28 ATPase Parvo_NS1 IstB_IS21 AAA_7 AAA_17 ABC_tran Viral_helicase1 ATPase_2 Bac_DnaA Sigma54_activat AAA_24 TsaE Zeta_toxin NACHT NB-ARC DUF2075 DUF815 ResIII Rad17
Other DBs
NCBI-GeneID: 1276315
NCBI-ProteinID: XP_315644
VectorBase: AGAP005630
UniProt: Q7PIQ3
Position
2L
AA seq 804 aa
MADSKNDDLATAILKRKDRPNRLIVDEAANDDNSVISLSQAKMDELELFRGDTVLLKGKR
RKETVCIVLSDENCPDEKIRMNRVVRNNLRVWLGDVVMIQSCPDVKYGKRVHILPIDDTV
EGLSGNLFDVYLKPYFLEAYRPIHKDDTFIVRGGMRAVEFKVVAADPEPYCIVAPETVIH
CEGNPIKREEEEETLNAVGYDDIGGCRKQLAQIKEMVELPLRHPSLFKAIGVKPPRGILM
YGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAIIFI
DEIDAIAPKREKTHGEVERRIVSQLLTLMDGMKKSSHVIVMAATNRPNSIDPALRRFGRF
DREIDIGIPDATGRLEVLRIHTKNMKLADDVDLEQIAAESHGHVGADLASLCSEAALQQI
REKMDLIDLEDDQIDAEVLNSLAVSMENFRYAMTKSSPSALRETVVEVPNTTWTDIGGLE
NVKRELQELVQYPVEHPDKFLKFGMQPSRGVLFYGPPGCGKTLLAKAIANECQANFISVK
GPELLTMWFGESEANVRDIFDKARSASPCVLFFDELDSIAKSRGGNVGDAGGAADRVINQ
ILTEMDGMGAKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSREAILRANLRK
SPVAEDVDLNYVAKVTQGFSGADLTEICQRACKLAIRQAIEAEIRRERDRAASQNAAMDM
DEEDPVPEITRDHFEEAMKFARRSVSDNDIRKYEMFAQTLQQSRGFGTNFRFPSGQGASS
SQGQGSSQPTSNNPGDNGDDDLYS
NT seq 2415 nt   +upstreamnt  +downstreamnt
atggccgacagcaagaacgatgatttggcaactgccatcctgaagcgcaaggatcgcccg
aaccgcttgatcgtcgacgaagccgctaacgatgacaactcggttatttcgttgtcacag
gcaaaaatggacgagctggagctgttccgcggcgacacggtactgttgaagggcaagcgc
cggaaagagacggtctgcatcgtcctgtcggacgagaactgcccggacgagaagatccgc
atgaaccgggtggtgcgcaacaatctgcgcgtctggctcggcgacgtggtgatgatccag
tcctgcccggacgtcaagtacggcaagcgcgtccacatcctgccgatcgacgacacggtc
gagggtctgtcgggcaacctgttcgacgtgtacctgaagccgtacttcctggaggcatac
cggcccatccacaaggacgacacgttcatcgtgcgcggcggcatgcgggcggtcgagttt
aaggtggtcgcggccgatccggagccgtactgcatcgtcgcaccggagacggtgatacac
tgcgagggcaatccgatcaagcgcgaggaggaggaggaaacgctgaacgcggtcgggtac
gacgacatcggcggatgccgcaagcagctggcgcagatcaaggagatggtcgagctgccg
ctgcgccatccgtcgctgttcaaggcgatcggtgtgaagccgccgcgcggcattctcatg
tacggtccgcccggtacgggcaaaacgttgatcgcgcgtgcggtcgcgaacgaaaccggt
gcgttcttcttcctgatcaatgggccggaaattatgtccaagctggcgggcgagtcggag
tccaatctgcgcaaagcgttcgaggaggcggagaagaactcgccggcgatcatcttcatc
gacgagatcgacgcgattgcgccgaagcgcgagaagacgcacggtgaggtggagcggcgc
atcgtgtcccagctgctcacgctgatggacggcatgaagaagagctcgcacgtgatcgtg
atggcggccacgaatcggccgaactcgatcgacccggccctgcgtcggttcggacgcttc
gatcgcgaaatcgacatcggcattccggatgcgaccggccggctggaggtgctgcgcatc
cacaccaaaaacatgaagctggcggacgacgtcgacctggagcagattgcggccgaatcg
cacggtcacgtcggggccgatctggcgtcgctctgctcggaggcggcgctgcagcagatc
cgcgagaagatggacctgatcgacctggaggacgaccagatcgacgcggaggtgctgaac
tcgctggccgtctcgatggagaacttccgctacgcgatgaccaagtcgagcccgtcagcg
ctgcgcgaaaccgtggtcgaagtgccgaacacgacctggaccgacatcggcgggctggag
aacgtgaagcgcgagctgcaggagctggtccagtatccggtcgagcatccggacaagttc
ctcaagttcggcatgcagccgtcgcgcggcgtgctgttctatgggccgcccggttgcggt
aagacgctgctcgccaaggccatcgccaacgagtgccaggcgaacttcatctcggtcaag
ggcccggagctgctgaccatgtggttcggcgagtcggaggcgaacgtgcgcgacatcttc
gacaaggcccgttccgcgtcgccgtgcgtgctgttcttcgacgagctggacagcatcgcc
aagtcgcgcggtggcaacgtgggcgatgcgggcggtgcggccgaccgcgtgatcaaccag
atcctgaccgagatggacggcatgggggcgaagaagaacgtgttcatcatcggggcgacc
aaccggccggacatcatcgatcccgccatcctgcgcccgggccgtctggaccagctgatc
tacattccgctgccggacgagaagtcgcgcgaggcgattctgcgcgccaacctgcgcaag
agcccggtcgcggaggacgtggacctgaactacgttgccaaggtgacgcagggcttctcc
ggtgccgatctgacggaaatctgccagcgggcctgtaagctggccattcgtcaggcgatc
gaggcggaaattcgccgcgagcgggaccgtgccgccagccagaacgcggcaatggatatg
gatgaggaagatccggtgccggaaattacgcgcgaccatttcgaggaagcgatgaagttt
gcccgccgttcggtgtccgacaacgacatccgcaagtacgaaatgtttgcccaaacgctg
cagcaatctcgtggattcggtactaacttccgattcccctcgggacagggcgcctccagc
tcgcagggccagggttcgtcgcaaccgacgagcaataatcccggcgacaacggtgacgac
gatctctacagttag

DBGET integrated database retrieval system