KEGG   Anopheles gambiae (mosquito): AgaP_AGAP006020
Entry
AgaP_AGAP006020   CDS       T01036                                 

Name
(RefSeq) AGAP006020-PA
  KO
K00502  tryptophan 5-monooxygenase [EC:1.14.16.4]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00380  Tryptophan metabolism
aga00790  Folate biosynthesis
aga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AgaP_AGAP006020
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AgaP_AGAP006020
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.4  tryptophan 5-monooxygenase
     AgaP_AGAP006020
SSDB
Motif
Pfam: Biopterin_H ACT QRPTase_N
Other DBs
NCBI-GeneID: 1276687
NCBI-ProteinID: XP_316057
VectorBase: AGAP006020
UniProt: Q7Q665
Position
2L:complement(24907402..24911813)
AA seq 531 aa
MSGSGKGLLGLWLYHSGDQEWAVKEGSPLHRRKEFATFVSSYMKRAQPNVTTLSVSPPTM
QKSADHSNGNERNGSDRTSIIFTLKNQIGGLASALRVFQELGINVLHVELNKSGEMCDSA
DVLVDIECDANRLEQVLRLLKREVQSVNYAAQISSDGPPPTPLSACGSFDFGEMHWFPRK
ISDLDRAQNVLMYGSELDADHPGFKDPVYRKRREQFAAIANSYKHGSPIPRVQYTPEEIK
TWGTVFRELHKLYIKHAVPEYLENWPELVKYCGYREDNLPQLQDINVFLKRKTGFQIRPV
AGYLSPRDFLSGLAFRVFHCTQYIRHSSDPFYTPEPDCCHELLGHMPLLANSSFAQFSQE
IGLASLGASEEDINKLATLYFFTVEFGLCRQQDGSFKVFGAGLLSSVAELQHAITTTDKI
KRFDPEVTCQEECIITAYQNAYYYTDSFEEAKEKMRAYADTIQRPFGVRYNPYTQTVEVL
SNAKKITAVVSELRGDLSIVSSALKKVSAMDENLDVEKIEKLLSSSLHVSV
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgagtggttccggcaaaggattattgggattatggctgtaccatagcggcgatcaggag
tgggccgttaaggagggcagcccgttacatcggcggaaggaatttgctacatttgttagt
tcttacatgaaacgcgctcaaccgaatgtaacgaccctatctgtatcacccccaacaatg
cagaaatcggccgaccacagcaatggcaatgagcgcaacggatccgaccgcacgtcgatc
atcttcacgctgaagaaccaaatcggtggtctggccagtgcgctgcgcgtgttccaggag
ctcggcatcaacgtgctgcacgtggagctgaacaagagcggcgaaatgtgcgacagtgcg
gacgtcctggtcgacatcgagtgtgatgccaaccggctcgagcaggtgctgcgactgcta
aagcgcgaagtgcagtcggttaactacgccgcccagattagcagcgatggaccaccgcca
acgccactgtccgcttgtggtagtttcgatttcggcgagatgcattggttcccgcggaag
atatccgacctggaccgggcgcagaacgtgctgatgtatggcagcgagctggatgcggac
catcccgggtttaaggatccggtgtaccgcaagcgtcgagagcagtttgcggccattgcc
aactcctacaagcatggcagtcccatcccgagagttcagtacacaccggaggaaatcaaa
acctggggtacggtgttccgtgagctgcacaagctctacatcaagcacgccgtgccggag
tatctggagaactggcccgagctggtgaagtactgcggctaccgggaggacaatctgccc
cagctgcaggacatcaacgtgtttctgaagcgcaaaaccggcttccaaatccgccccgtt
gccggttacctctcaccgcgcgacttcctgtccgggttggcgttccgggtgttccactgc
acccagtacatccgccactcgtccgatccgttctacacgcccgaacccgactgttgtcac
gagctgctcgggcatatgccgctcctagccaactcgagctttgcgcagttttcgcaggag
attgggctcgcttcgctcggtgcgtccgaggaggatattaacaagctggcgacgctgtac
ttcttcacggtcgagtttgggctgtgccgtcagcaagatggcagctttaaggtgtttggg
gccgggttgctttcgtcggtggcggagctgcagcacgcaatcaccacgacggataagatc
aagcggttcgatccggaggtgacgtgccaggaggagtgcatcatcacagcgtaccagaac
gcgtactactacacggactcgttcgaggaggcgaaggagaagatgagggcttatgcggac
accattcagcgcccgttcggtgtgcggtacaatccgtacacgcaaacggtggaggtgctg
agcaatgcgaagaagatcacggccgtcgtgagtgagctgcgcggtgatctgagcattgtt
tcgtccgccctgaagaaggtgtccgcgatggatgaaaacctggacgtggaaaagattgag
aagctgctgtcgagcagtttgcatgtgagtgtatga

DBGET integrated database retrieval system