KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP006263
Entry
AgaP_AGAP006263   CDS       T01036                                 
Symbol
ARR2
Name
(RefSeq) AGAP006263-PA
  KO
K13805  arrestin-2
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga04745  Phototransduction - fly
Brite
KEGG Orthology (KO) [BR:aga00001]
 09150 Organismal Systems
  09157 Sensory system
   04745 Phototransduction - fly
    AgaP_AGAP006263 (ARR2)
SSDB
Motif
Pfam: Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 1276917
NCBI-ProteinID: XP_316327
VectorBase: AGAP006263
UniProt: Q7Q5Q8 B1Q295
Position
2L
AA seq 398 aa
MVVAVKVFKKSAPNGKLTVYLGKRDFIDHTDYCDPIDGVIVLDEEYLRGRKVFGQLITTY
RYGREEDEVMGVKFSKEMVLTKEQIYPMENANMEMTPMQERLVKKLGANAFPFTFHFPSM
APSSVTLQAGEDDTGKPLGVEYAIKAHVGEDESDKGHKRSAVTLTIKKLQYAPVSRGRRL
PSSLVSKGFTFSQGKINLEVTLDREIYYHGEKIAANIVVTNNSRKTVKSIKCFVVQHCEV
TMVNAQFSKHIASLETREGCPITPGASFTKSFFLVPLASSNKDRRGIALDGHLKEDDVNL
ASSTLISEGKCPSDAMGIVISYSLRVKLNCGTLGGELQTDVPFKLMNPAPGSVERERVNA
LKKMKSIERHRYENSHYADDDDNIVFEDFARLRMNEPE
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggttgtcgcagtgaaagtgtttaaaaaatccgccccgaatggcaaactgaccgtctat
ctcggcaagcgtgacttcatcgaccacaccgactactgtgacccgatcgatggcgttatc
gtgctggacgaggagtacctgcgaggccgcaaggtcttcggccagctcatcaccacctac
cgctatggccgggaagaggatgaggtgatgggcgtgaagttctccaaggagatggtgctg
accaaggaacagatctacccgatggagaacgccaacatggagatgacgcccatgcaggag
cggctggtgaagaagctgggcgcgaacgcgttcccgttcaccttccacttcccgagcatg
gcgccgagctcggtgacgctgcaggccggtgaggacgacacgggcaaaccgctcggcgtc
gagtacgcgatcaaggcgcacgtcggcgaggacgagagcgacaagggccacaagcgcagc
gccgtcacgctgacgatcaagaagctccagtacgcgccggtgtcccgcggtcgtcgtctt
ccttcgtcgctcgtcagcaagggcttcaccttctcgcagggcaagatcaacctggaggta
acgctcgatcgggagatctactaccacggcgagaagattgcggccaacatcgtcgtgacg
aacaactcgcgcaagactgtcaagagcatcaagtgcttcgttgtgcagcactgtgaggtc
acgatggtgaatgcacagttcagcaagcacatcgcctcgctggagacgcgcgagggttgc
ccgatcacgcccggggcgagcttcacgaaatcgttcttcctggtcccgctcgcctccagc
aacaaggaccgccggggcattgcgctcgacggccacctgaaggaggatgacgtcaacctg
gcctcgtccacgctgatcagcgagggcaagtgtccgtcggatgcgatgggtattgtcatc
tcgtactcgctgcgcgtcaagctcaattgtggcacgctcggtggcgaactccagacggac
gtaccgttcaagctgatgaacccagcacctggatctgtcgagcgagagcgcgtgaacgcc
ctgaagaagatgaagtcgatagagcgtcaccgttacgagaactcgcactacgccgacgat
gacgacaacatcgtgttcgaagactttgcccgcctgcggatgaacgagccggagtaa

DBGET integrated database retrieval system