KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP006569
Entry
AgaP_AGAP006569   CDS       T01036                                 
Name
(RefSeq) AGAP006569-PA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00010  Glycolysis / Gluconeogenesis
aga00620  Pyruvate metabolism
aga00630  Glyoxylate and dicarboxylate metabolism
aga00640  Propanoate metabolism
aga01100  Metabolic pathways
aga01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AgaP_AGAP006569
   00620 Pyruvate metabolism
    AgaP_AGAP006569
   00630 Glyoxylate and dicarboxylate metabolism
    AgaP_AGAP006569
   00640 Propanoate metabolism
    AgaP_AGAP006569
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aga01004]
    AgaP_AGAP006569
Enzymes [BR:aga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AgaP_AGAP006569
Lipid biosynthesis proteins [BR:aga01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AgaP_AGAP006569
SSDB
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Other DBs
NCBI-GeneID: 1277153
NCBI-ProteinID: XP_316594
VectorBase: AGAP006569
UniProt: Q7Q597
Position
2L
AA seq 669 aa
MPSEPEKIFNPHPDVASKAYINSMQQYREFYQQSLENPGQFWANVAKQFHWETPYDPKNF
FSYNFDISKGPIYVKWMEGASTNICYNLLDRNVKNGLGDTVAYYWEGNHPDDYSRLTYRK
LLEEVCRFANVLKSHGVQKGDRVSIYMPMTMELPVAMLACARIGAVHSIVFAGFSSDSLA
ERMHDCQAKVLITADGAWRGEKILHLKDICDTAMDKAEELGHHVQTCIVVSHINRVTPGK
EDWDGSFDTPWRDGRDFWWHQEMEDAEPACYPEWMSAEDPLFMLYTSGSTGKPKGVLHTT
AGYLLYAATTFKIVFDYKPNDIYWCTADIGWITGHTYVLYGPLANGATSVMFEGTPFFPD
TDRYWEIIDKYKVSQFYTAPTAIRSLMKFGDEPVLKHDLSSLRVLGSVGEPINPEAWLWY
YRVIGKERCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDESGTEITG
EGEGYLVFSQPWPGMMRTLFNNHPRYESTYFSKFNGYYCTGDGARRDADGYFWVTGRVDD
MLNVSGHLMSTSEVESVLTEHPRVSEAAVVSRPHPVKGECLYCFITPNQNEAFDKTLISE
LKVLVRERIGPFAQPDVIQHAPGLPKTRSGKIMRRVLRKVAVNDRDVGDTSTLADEAIIE
QLFANRPAH
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgccgtcggaaccggagaagattttcaacccccatccggatgtcgccagcaaggcgtac
atcaacagtatgcagcagtaccgcgagttttaccagcagtcgctggagaatccgggccag
ttctgggccaatgtggccaagcagttccactgggagacgccgtacgatccgaagaacttc
ttctcgtacaacttcgacatctcgaaaggtcccatctacgtaaagtggatggagggtgcc
tcgaccaacatttgctacaacttgctggatcgcaacgtgaagaacgggctcggcgatacc
gtcgcttactactgggaaggcaatcatcccgatgactacagccggctaacgtacaggaag
ctgctcgaggaggtatgccggttcgcgaacgtgctaaagagccacggcgtccagaagggt
gaccgggtgtcgatctacatgcccatgaccatggagctgccggttgcaatgctggcctgt
gcacgcatcggtgccgttcactcgattgtgtttgccggtttctcgtccgattcgctcgcc
gagcgcatgcacgactgccaggcgaaggtgctgatcacggccgacggtgcctggcggggc
gagaagatcctgcacctgaaggacatctgtgataccgcgatggacaaggcggaagagctc
ggccaccacgtgcagacgtgcattgtcgtgtcgcacattaaccgggtcacgccgggcaag
gaggactgggacggttcgttcgataccccatggagagatggacgcgacttttggtggcac
caggagatggaggacgccgaaccggcctgctacccggagtggatgtcggccgaggaccca
ctgtttatgctgtacactagcggctcgaccggcaaaccgaagggtgtgctgcatacgacc
gccggctacctgctgtacgcggccacgaccttcaagatcgtgttcgactacaagccgaac
gatatctactggtgcacggccgacatcggttggattacgggccacacgtacgtgctgtac
ggtccgctcgctaacggtgccacctcggtcatgttcgagggcacaccgttcttcccggac
acggaccggtactgggagatcatcgacaagtacaaggtgtcgcagttttataccgcaccg
accgcgatccggtcgctgatgaagtttggcgacgagccggtgctgaagcatgatctatcg
agtcttagagttctcggtagtgtcggtgagccgatcaatccggaagcgtggctttggtac
tatcgggtgatcggcaaggagcgctgttcgatcgtggacaccttctggcagacggagaca
ggcggacacgtgattacacccctgccgggcgctacaccaatgaagcctggctctgcatca
ttcccgttctttggcgtgaaaccgacgctgctggacgaaagcggtacggaaattacgggc
gaaggtgaaggctatctcgtcttttcccagccctggccgggtatgatgcgcacgctgttc
aacaaccatccgcgctacgaatcgacgtacttttccaagttcaatggatactactgtacg
ggtgatggcgcacgtcgcgatgcggacggctacttctgggtgacggggcgcgtcgacgac
atgctgaacgtgtcgggccatctgatgtccacgtcggaggtcgagtcggtgctgaccgag
catccgcgcgtctcggaagcggccgtcgtatcccgacctcacccggtcaagggcgaatgt
ttgtactgcttcatcacgcccaaccagaacgaagcgttcgacaaaacgctcatcagcgag
ctgaaggtgctggtgcgggagcgcatcggtccgttcgcgcagccggacgtgatccagcat
gcgcccgggctgccgaaaacgcgctcgggcaagattatgcgacgagtgctgcgcaaggtg
gccgtcaacgatcgggatgtgggcgatacgtccacactggcggacgaggccatcatcgag
cagctgtttgctaaccggccggcccactaa

DBGET integrated database retrieval system