KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP006894
Entry
AgaP_AGAP006894   CDS       T01036                                 
Name
(RefSeq) AGAP006894-PA
  KO
K00804  geranylgeranyl diphosphate synthase, type III [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00900  Terpenoid backbone biosynthesis
aga01100  Metabolic pathways
Module
aga_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AgaP_AGAP006894
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:aga01006]
    AgaP_AGAP006894
Enzymes [BR:aga01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     AgaP_AGAP006894
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     AgaP_AGAP006894
    2.5.1.29  geranylgeranyl diphosphate synthase
     AgaP_AGAP006894
Prenyltransferases [BR:aga01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   AgaP_AGAP006894
SSDB
Motif
Pfam: polyprenyl_synt Terpene_syn_C_2
Other DBs
NCBI-GeneID: 1270183
NCBI-ProteinID: XP_308860
VectorBase: AGAP006894
UniProt: Q7QII9
Position
2L
AA seq 324 aa
MNMHELYEIIEKCHDKSSQKEQDETLLQPFSYIQQIPGKQVRSKLALAINHWLHIPNDKL
AAISEIVQMLHNSSLLIDDIEDNSILRRGIPVAHKIYGVASTINAANYVLFLALEKVQQL
GHPDATRVYTEQLLELHRGQGMEIYWRDNYACPTETEYKQMTIRKTGGLFMLAIRLMQLF
SENRKDFTKLTAILGLYFQIRDDYCNLSMKEYSENKSYCEDLTEGKFSFPVIHAIQTQKY
DKQVLHILRQRTRDVEVKRYCITLLEKLGSFQYTRDVLESLDKEARKEVESLGPNPIMEA
LLNDLLSWKQVSDGMTVDDDTTPP
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaatatgcatgaattgtatgaaattatagaaaagtgtcacgacaagtcatcccagaag
gaacaggatgagacgctgctgcaaccattttcgtacatccagcaaattcccggaaagcag
gtccggtcgaagctagcgctcgcgataaaccattggctacacattccgaacgacaagctg
gcggcgataagtgagattgtccaaatgctgcacaattccagcttgctcatcgacgatatc
gaagacaattctatccttcgcagaggcatcccggtggcgcacaaaatctacggcgtggcg
agcacgatcaatgcggccaactatgtgctatttttagcgctggaaaaggtccagcagctc
ggccatccggatgcgacgcgggtgtacacggagcagctgctggagctgcaccgtggccag
ggtatggagatctactggcgcgacaactacgcctgcccgaccgagacggagtacaagcag
atgacgatacggaaaacgggcggcctgttcatgctggcgatccggctgatgcagctgttt
agcgagaatcgcaaagatttcaccaagctgaccgcgatcctggggctgtacttccagata
cgggacgactactgcaacctgagcatgaaggagtactcggaaaacaagagctactgcgag
gatctgaccgagggcaagtttagctttccggtcatacacgcgatacagacgcaaaagtac
gacaagcaggttttacacattctacgccaacggacgcgcgatgtcgaggtcaagcggtac
tgcataacgttgctggaaaagttgggcagctttcagtacacacgtgacgtgctagagtca
ctcgacaaggaagcacgaaaggaggtggaaagtcttggaccgaatccaattatggaagcg
ttgctgaacgatttgctcagctggaagcaagtttccgacggtatgacggtagatgacgac
acgacgccaccgtaa

DBGET integrated database retrieval system