KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP007157
Entry
AgaP_AGAP007157   CDS       T01036                                 
Name
(RefSeq) AGAP007157-PA
  KO
K02978  small subunit ribosomal protein S27e
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aga00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AgaP_AGAP007157
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aga03011]
    AgaP_AGAP007157
Ribosome [BR:aga03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    AgaP_AGAP007157
  Archaea
    AgaP_AGAP007157
SSDB
Motif
Pfam: Ribosomal_S27e Prok-RING_1
Other DBs
NCBI-GeneID: 1269957
NCBI-ProteinID: XP_308611
VectorBase: AGAP007157
UniProt: Q7PT96
Position
2L
AA seq 84 aa
MPLAKDFLHPLPAEEKRKHKLKRLVPHPNSYFMDVKCPGCYKITTVFSHAQSVVVCAGCS
TILCQPTGGKARLTEGCSFRRKPY
NT seq 255 nt   +upstreamnt  +downstreamnt
atgccgctcgccaaggacttcttgcacccgctgcccgctgaggagaagaggaagcacaag
ctgaagcgcctggtgccccatccgaactcgtacttcatggacgtgaagtgccccggctgc
tacaagatcaccaccgtcttcagccatgcccagagcgtcgtagtgtgtgccggctgctca
acgatcctgtgccagccgaccggcggcaaggcgcgtctgaccgagggctgctcgttccgc
aggaagccgtactaa

DBGET integrated database retrieval system