KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP007168
Entry
AgaP_AGAP007168   CDS       T01036                                 
Name
(RefSeq) AGAP007168-PA
  KO
K03845  alpha-1,3-mannosyltransferase [EC:2.4.1.258]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00510  N-Glycan biosynthesis
aga00513  Various types of N-glycan biosynthesis
aga01100  Metabolic pathways
Module
aga_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    AgaP_AGAP007168
   00513 Various types of N-glycan biosynthesis
    AgaP_AGAP007168
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aga01003]
    AgaP_AGAP007168
Enzymes [BR:aga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.258  dolichyl-P-Man:Man5GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase
     AgaP_AGAP007168
Glycosyltransferases [BR:aga01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   AgaP_AGAP007168
SSDB
Motif
Pfam: ALG3
Other DBs
NCBI-GeneID: 1269946
NCBI-ProteinID: XP_565033
VectorBase: AGAP007168
UniProt: Q5TWR0
Position
2L
AA seq 523 aa
MGKIPANQPKSVPPVPRKEPQTLLAKIRKEYVSLTFAKSLIFDPARLPLISILILAAELV
LNVFVVQNVRYTEIDWKAYMQECEGFLNGTTDYSQLRGDTGPLVYPAGFVYIYSALYFLT
SHGTNIRLAQYVFVGIYLVQLMLVLRLYCKSCKVPPYVMVITIFTSYRIHSIYVLRLFND
PIAILFLYAALNAFIDGRWTLGSVMLSLGVSVKMNILLFAPAILLLYITNLGWLKTALQL
TVCGVIQLILGAPFLLTHPWQYLKGSFDLGRVFEHKWTVNYRFLEPEVFESKVFHLALLG
LHLTLLLVFASPCYKYFQNYCRLRHLEMMLMPQIEAQNRAEKEKVKKGKQSKAKALPAAK
GDNGEEKLTQDQEKFLKSFEKGIKKMSGKQQQQQNVAPVETESPAAANPAANKFSIHFDR
STQLALLPIFLSNFIGIVCARSLHYQFYVWYFHSLPYLTWYTEYTNSLKFLLLLLLEFCW
NTYPSTVLSSVVLHACHVCLLVGIGRKLFRRIPDLAQLNNKTE
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggggaaaattccagccaatcaaccgaaatcggtgccgccggtgccgcggaaggaaccg
caaactctgctcgccaagatacgcaaagagtacgtaagcttaacgtttgccaaatcgctc
atcttcgacccggcccggttgccgctgatctcgatcctaattttggccgctgagttggtg
ctgaacgtgttcgtggtgcaaaatgtgcgctacaccgaaatcgactggaaggcgtacatg
caggagtgtgaagggtttctcaacggcaccaccgactattcgcagctacgaggtgatacc
ggcccgctcgtctatcctgccgggtttgtctacatctacagcgcgctgtacttcctaaca
tcacacggcaccaacattcgcttggcccagtatgtcttcgttggcatctatctggttcag
ctgatgctcgtactccggctgtactgtaagagctgcaaagtccctccatacgtgatggtc
attaccattttcacctcctaccggattcactccatctacgtgctgcggttgttcaacgat
ccgattgcgatcctgttcctctacgccgccctgaatgcgttcattgacggtcgatggacg
ctcggcagcgtaatgctcagcttgggcgtatcggtaaagatgaacatccttctgtttgct
ccggccattctgctgctgtacattaccaatctgggatggctgaaaacggcccttcagctg
acggtctgtggagtgatacagctgatcctgggtgctccgttccttcttacccatccgtgg
cagtaccttaagggtagcttcgatttggggcgcgtgttcgagcacaagtggacagtaaac
tatcgcttcctcgagccggaagtgttcgaaagtaaggtgtttcatctggcactgctcgga
ctgcatctcacgctgctgctcgtgtttgcatcgccctgctacaagtacttccaaaattac
tgccgcctgcgccacctggagatgatgctgatgccacagatagaggcacaaaatcgggcc
gaaaaggaaaaggtgaaaaagggcaagcaatcgaaagccaaagcattgccggctgctaaa
ggagacaacggggaggaaaagctaacgcaggatcaggaaaagtttttgaaatcgtttgaa
aagggcattaaaaagatgtccggtaagcagcagcagcagcagaatgtcgccccggtggaa
acggaatcaccggcagcagcgaacccagcggccaacaaattttccatccacttcgatcga
tccacccaactcgcgctgctccccattttcctgtccaactttatcggcatcgtttgtgcg
cgtagcttgcactaccaattttacgtgtggtacttccacagcttgccctacctcacttgg
tacacggagtatacgaacagtttgaagtttttgcttcttctgctgctggaattctgctgg
aacacgtacccgagcacggtactgagcagcgtggtcctgcacgcctgccacgtgtgcctg
ctggttggcattggaaggaaattgttccgtcggattccggatcttgctcagctgaacaat
aagacagagtaa

DBGET integrated database retrieval system