KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007209
Entry
AgaP_AGAP007209   CDS       T01036                                 

Name
(RefSeq) AGAP007209-PB
  KO
K06497  CD63 antigen
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    AgaP_AGAP007209
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aga04147]
    AgaP_AGAP007209
   04090 CD molecules [BR:aga04090]
    AgaP_AGAP007209
Exosome [BR:aga04147]
 Exosomal proteins
  Proteins found in most exosomes
   AgaP_AGAP007209
CD molecules [BR:aga04090]
 Proteins
  AgaP_AGAP007209
SSDB
Motif
Pfam: Tetraspanin Abhydrolase_9_N COX1 Endomucin
Other DBs
NCBI-GeneID: 1269922
NCBI-ProteinID: XP_001688004
VectorBase: AGAP007209
UniProt: A7URL1
Position
2L
AA seq 228 aa
MALNCGHSTIKYLLFIFNLLCSLCGIALIVIGAVSLVKLEELREISDEYNIVAPSILLIV
FGSVVFVISFFGCCGAIRESYCMTSTYSFFLILLVIAQIVIAVLVFVFVGDVTTAIKKGF
ERVFENRDNPVNADLVNSIQQNLQCCGKRSFLDYGVASFPQSCCSSGGTAPLCVPFASGC
LSRLSEFLDSAGNIVAWVSLGVAAVELVGLISACCLANAIRNQQRRYS
NT seq 687 nt   +upstreamnt  +downstreamnt
atggcgctcaactgtggacattcgacgataaagtatctgcttttcatctttaacctcctg
tgctcgctctgcggcattgcgctgatcgtgatcggtgccgtttcactggtgaagctcgag
gagctgcgcgagatcagcgatgagtacaacatcgtcgccccgtccatcctgctgatcgtg
ttcggctcggtcgtgtttgtcatctcgttcttcggctgctgcggtgctattcgcgaatcc
tactgcatgacctcgacctacagcttcttcctgattctgctcgtgatcgctcagattgtg
attgcggtgctggtgtttgtgttcgtcggtgatgtgaccaccgccatcaagaagggcttc
gagcgtgtgtttgagaaccgtgacaacccggtcaatgccgatctggtcaactccatccag
cagaacctgcaatgctgtggcaagcgtagcttcctggactatggcgtcgccagcttcccg
cagtcgtgctgcagcagcggcggaaccgctccgctgtgcgtgccgtttgccagcggctgc
ctgagccggctgtccgagttcctggacagtgccggtaacattgtcgcctgggtgtcgctc
ggtgtcgccgccgtcgagctggtcggtctgatctcggcctgctgtctggccaacgccatc
cgcaaccagcagagaagatacagctaa

DBGET integrated database retrieval system