KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007212Help
Entry
AgaP_AGAP007212   CDS       T01036                                 

Definition
(RefSeq) AGAP007212-PA
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:aga00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    AgaP_AGAP007212
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aga03041]
    AgaP_AGAP007212
Enzymes [BR:aga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     AgaP_AGAP007212
Spliceosome [BR:aga03041]
 Complex C
  Other components
   Step II factors
    AgaP_AGAP007212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE AAA_30 Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 1269919
NCBI-ProteinID: XP_308573
VectorBase: AGAP007212
UniProt: Q7PT33
Position
2L
AA seq 1288 aa AA seqDB search
MDELEQLEHLSLVSKICTELENHLGLNDKDLAEFIIDLAHKNPTIEAFKRVLVENGAEFS
DSFTTNLLRIIQLMKPAGKQSTSAFEDDANDGNNLAYKFPGLAIPNNKKAYSSDEEAEDD
TKHDKKRIEKYKDKKEEKKPLGGGDVVDDMFSELEQMAPSKGGKEGGKSREQLEVDNMFA
ELENLAPSKSTEEEKEVAKRRDRRSQSRERRRERSKSRDRRRDRSKSRDRRRRSRSKDRR
RRSRSKSRDRHDRDRTRDRDRDRDRDRGGRDRDRDRDRERDRRSRRSRSRSNSKERSRHR
NRSNSREPPAAMEKRRMPPPMPEEPEPGHIYDGRVVNIVAFGCFVQLNGFRRKKEGLVHI
SQLSTEGRVNLVTDVVNRGDEVKVKVMSLAGNKISLSMKEVEQSSGRDLNPLSHAHLKEG
GDGEAGARNPDRPMTVPSMLNLQEGTLEQVEETSRKKVTRISSPERWEIKQMISSGVIDR
SEMPDFDEETGLLPKDEDSEADIEIEIVEDEPPFLQGHGRALHDLSPVRIVKNPDGSLAQ
AAMMQTALAKERREQKMLQREQEMDAVPTNMNKNWIDPLPDEDDERTAASNTRGVGMSTQ
DVPEWKKAIIGGKKSSFGRKTDMSLVEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSG
KTTQITQYLAESGFIARGKIGCTQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTS
QETVIKYMTDGMLLRECLVDFDLKSYSVIMLDEAHERTIHTDVLFGLLKQAVQKRPELKL
IVTSATLDAVKFSQYFFEAPIFTIPGRTFPVEILYTKEPETDYLDASLITVMQIHLREPP
GDVLLFLTGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSR
KVVIATNIAETSLTIDGIYYVVDPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGR
TGPGKAYRLYTERAYRDEMLPTPVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVES
LVMALEQLHSLSALDNEGLLTRLGRRMAEFPLEPNLSKLLIMSVALQCSDEVLTIVSMLS
VQNVFYRPKDKQALADQKKAKFNQIEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLK
RAQDVRKQLLGIMDRHKLDVVSAGKNTVRVQKAICSGFFRNAAKKDPQEGYRTLVDSQVV
YIHPSSALFNRQPEWVVYHELVQTTKEYMREVTTIDPKWLVEFAPAFFRFSDPTKLSKFK
KNQRLEPLYNKYEEPNAWRISRTRRRRN
NT seq 3867 nt NT seq  +upstreamnt  +downstreamnt
atggatgaattggagcagcttgagcacctttcgctggtgtccaagatatgcacggaactg
gaaaaccatctcggtttgaacgacaaagatttggcggaatttatcatcgatctcgcacac
aaaaatcccaccatcgaggcgttcaagcgtgtgctggtcgagaatggggccgaattttcc
gactcgttcacaacgaacctgctgcgtatcatacagctgatgaagcccgccgggaagcag
agcacatccgcgttcgaggacgacgcaaacgatggcaacaaccttgcgtacaagtttccc
ggcttggcgataccgaacaacaaaaaagcgtactcctcggacgaggaagcggaggacgac
acgaagcacgacaaaaagcggatagaaaagtataaagacaagaaggaggaaaagaaaccc
ctgggcggtggtgatgtggtggacgatatgttttcggagttggaacagatggcaccatcg
aagggaggcaaagagggtggaaaatcgcgcgaacagctcgaggtggacaacatgtttgcg
gagctggagaatctagccccttccaagtcgaccgaagaggaaaaggaagtggcgaagcgt
cgcgatcgccgtagccagtcgcgcgaacgaaggagagagcgcagcaaatcgagagacagg
cgtcgggatcgaagcaaatcacgggatcgtcgaagaagaagcagatccaaggatagaaga
cgcagaagtcgatccaaaagtcgtgatcggcatgatcgagatagaacaagggaccgggac
cgggaccgggaccgcgatcgtggaggtcgagaccgtgatcgagatcgtgatcgggagcgt
gatcggcggtcgagaagaagccgttcgcgcagcaattcgaaggaacggtcccgccatcgc
aatcgaagcaattcccgggaaccgcctgcggccatggagaagcgcagaatgcctccaccc
atgccggaagagccggaaccgggccatatctacgacgggcgcgtggtgaacattgtcgcg
ttcggatgcttcgtacagctgaatgggttccggcgcaaaaaggaaggcttggtgcacatt
tcgcagctttccaccgagggcagagtaaatctcgtgaccgatgtcgttaaccgcggtgac
gaagtgaaggtgaaggtgatgtccctggcggggaacaaaatttccctcagcatgaaagag
gtggagcaatcgagcggacgggatctgaacccactttctcacgcacatttgaaggaaggg
ggcgatggggaagcaggcgcccgcaatcccgatcgtccaatgaccgttccgtcgatgctg
aacctccaggagggcacgctggagcaggtggaagaaacgtcccgcaagaaggtgacgcgt
atctcttcgcccgagcgctgggagattaagcaaatgatctcgtccggtgtgatcgatcgc
tccgagatgcccgactttgacgaggagacgggtctgctgccgaaggatgaggacagtgag
gcagacattgagatagaaatcgtggaagatgagcccccgttcctgcagggccatggacgc
gccctgcacgacctttcgccggtgcgaatcgtgaagaatccggacggttcgctcgcccag
gcggccatgatgcagacggcactggcgaaggagcggcgcgagcagaagatgctgcagcgc
gagcaggagatggacgcggtgccgaccaacatgaacaagaactggatcgatccgctgccg
gatgaggatgacgagcggacggcggcgtccaatacgcgcggtgtcggcatgtccacgcag
gacgtgccggagtggaagaaggccatcattggcggcaagaagagctcgttcgggcgcaaa
accgacatgagcctggtggagcagcgccaatcgctgcccatctacaagctgcgcgacgat
ctcatcaaggccgtcaccgacaaccagatactgatcgtgatcggcgagacgggctcgggt
aaaacgacgcaaatcacgcagtacctcgcggagagcgggtttattgcgcggggcaagatt
ggctgtacgcagccgcgtcgtgttgcggccatgtcggtggcaaagcgcgtggcggaggag
tacggttgccgactcgggcaggaggttggctacacgatccgcttcgaggactgcacgagc
caggaaacggtgatcaagtacatgacggacggcatgttgttgcgtgagtgtttggtggat
tttgacctcaaatcgtactcggtcatcatgctggacgaagcgcacgagcgtacgatacac
acggatgtgttgtttgggctgctgaagcaagccgtccagaagcgaccggaactgaagctg
atcgtcacgtcggccacgctcgatgcggtcaagttttcgcagtatttcttcgaagcaccc
atctttaccatccccggacgaacgtttccggtggagattctctacacgaaggagccggaa
acggattatctggacgcatcgctcatcaccgtcatgcagatccatctgcgtgaaccgcca
ggggatgtgctgctcttcctcaccggtcaggaggagattgatactgcctgtgagattctg
tacgagcggatgaagtcgttgggtccggacgttccggaactcatcatcctgcccgtctac
tctgccctcccgtcggaaatgcaaacgcgcatcttcgatccggccccacccgggagccgt
aaggtcgtaattgcaaccaacatcgccgaaacgtccctaacaatcgacggaatctactac
gtggtggatcccggcttcgtcaagcaaaaggtgtacaactcgaaaacgggcatggattcc
ctggtggttacgcccatctcgcaagcggccgccaaacaacgggcgggccgtgccggtcgt
accgggccgggcaaagcctaccggctctacacggagcgcgcctatcgggatgaaatgttg
cccaccccggtgccggaaattcagcgaaccaatctagccaccacggtactgcagctgaaa
acgatgggcattaacgatctgctgcactttgatttcatggatgcgccgccggtggaatcg
ctggtgatggcgctggaacagctccactcgctatcagccctcgacaatgaaggtttgctc
acgcggctcggccgaaggatggcagagtttccgctcgagccgaacctttctaagctgctg
atcatgtccgtagcgctccagtgctccgacgaagtgctgacgatcgtttccatgctttcg
gtgcagaacgtgttctaccggccaaaggacaaacaagcactggccgatcagaagaaggca
aagtttaaccaaatcgagggtgaccatttgacgctgctggccgtttacaatagctggaag
aataataagttctcgaacgcctggtgttacgagaactttgtccagattcgtacgctgaag
cgggcacaggacgtgcgcaagcagctgctgggcattatggatcgacacaagctggacgtg
gtttcggcgggcaagaatacggtacgcgtgcagaaagcgatctgctctgggttcttccgc
aatgcggccaagaaggacccgcaggagggctaccgaacgttggtggattcgcaggtcgtt
tacattcatccatccagtgcactgttcaaccggcaaccggaatgggttgtctatcacgag
ctcgtccagacgacgaaggagtacatgcgcgaggtgaccacgatcgatccgaaatggttg
gtagagtttgcaccggccttcttccgcttctcggaccccacgaagctcagcaagttcaaa
aagaaccaacggctggaaccgctgtacaacaagtacgaggaaccgaacgcgtggcgtatc
agcagaacccgaaggcgtcgcaattaa

DBGET integrated database retrieval system