KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007550
Entry
AgaP_AGAP007550   CDS       T01036                                 

Name
(RefSeq) AGAP007550-PA
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00910  Nitrogen metabolism
aga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AgaP_AGAP007550
Enzymes [BR:aga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     AgaP_AGAP007550
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 1269682
NCBI-ProteinID: XP_001687895
VectorBase: AGAP007550
UniProt: Q7QJJ8
Position
2L:47525155..47535554
AA seq 392 aa
MMAATTTTATTTTTTMAARVGHCSRSHRRRGSSGAGGGVMLIASILVLSVHYGHAQDFGY
DGDKGPSHWGEQYNSCTGKHQSPININSLDVKKVNLPPLVFQGFDVSPRETNLTNNGHTV
VVTMESEVTPTVSGGPLTGVYEYSQLHFHWGDNDTFGSEDMIDNHRFPMELHVVFFKQEY
KNARTALNHPDGLTVLAFFFEIAPDDNPMYQEFIELLGNVTGSHLSARFDTPPSLKDLIA
DDLLHYYTYDGSLTTPPCSEVVTWIDFKEPILLSHAQVQAFRALENEEGHPLTHNFRPVQ
PLGDRVVLYNTDEIIKQVDLDGEQPEEPSEAGVDTNQLDTGRSDEAPKAPSDPNGRKHPR
NAGTPSIATRWSSVLVVALPLLWAAFLRSERY
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgatggcagcgactaccactacggcgacgacgacgacgacgacgatggcggctcgtgtc
ggccattgtagtagaagccaccgaaggcggggcagcagtggcgctggcggtggtgttatg
ctaatcgcatcaattttggtattatcagtccattatggccacgcacaggattttggatac
gatggcgataaaggaccctcccactggggtgaacagtacaattcctgcaccggcaagcac
cagagccctatcaacatcaactcgctcgacgtgaagaaggtcaatctgccaccgctagtg
tttcaaggcttcgatgtttcaccccgcgaaacgaacctcaccaacaacggtcataccgtg
gtcgtcacgatggagtccgaggtaacgccgaccgtgtctggagggccgcttacgggcgtt
tacgagtactcgcagcttcacttccactggggcgataacgatacgtttggtagcgaggat
atgatcgataaccatcgctttcccatggagctgcacgtggtgttcttcaagcaggagtac
aaaaacgcacgcaccgcactgaaccatcccgatgggttgacggtgttggcgtttttcttc
gagatcgcgcccgacgacaatcccatgtatcaggagtttatcgagctgctggggaatgtc
accggtagccacctttccgcccggttcgatacaccgccatcgctcaaggatctgattgcg
gacgatttgctgcattactacacgtacgatggttcgctgacgacaccgccctgcagcgag
gtggtcacatggatcgattttaaggaaccgatcttactatcgcacgcacaggtacaagca
ttccgagcgctggaaaatgaagaaggacacccactgacacacaacttccgtccggtgcaa
ccgctcggcgatcgggtggtgctctacaacacggatgagattatcaagcaggtcgatctg
gatggtgagcagccggaggagccgtcggaggccggcgttgacaccaaccagctcgatacg
ggccggtcggacgaagcgccaaaagcacccagcgatccgaacggcagaaagcatccgcgc
aatgctggcacaccatcgatcgcaactcggtggtcgtcggtgctggttgtcgcgctgccg
ttgctatgggccgctttccttcgctcggaacgatactaa

DBGET integrated database retrieval system