KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007575Help
Entry
AgaP_AGAP007575   CDS       T01036                                 

Definition
(RefSeq) AGAP007575-PA
Organism
aga  Anopheles gambiae (mosquito)
SSDB OrthologParalogGFIT
Motif
Pfam: Polysacc_synt_4
Motif
Other DBs
NCBI-GeneID: 1269654
NCBI-ProteinID: XP_308299
VectorBase: AGAP007575
UniProt: Q7QJM0
Position
2L
AA seq 153 aa AA seqDB search
MDVLSRPAEEFVNDGTVEELWAVKAVDHAEVHFNLLCSVDPRLLRLTPYDDEIYEQFRRM
FPDMDVRVVNESELKSSDGKTKWRAYMEKFNRLEDFSYGTLLRSDAEEEFRPENAILVVR
IQFWAIEVARNREGHNDIVRMKFRGRNVNRDVE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggacgtactctcgagaccggcggaagaattcgtcaacgatggcacggtggaggagctg
tgggctgtgaaggcggtcgaccatgccgaggtacacttcaatctcctgtgcagtgtcgat
ccgcgcctgctacgactgactccgtacgatgacgagatctacgagcagttccggcggatg
ttccccgacatggacgtgcgggtggtgaacgaaagcgagctgaaaagctcggacggcaaa
acgaaatggagagcgtacatggagaagttcaaccggttggaagatttcagctacggcacg
ctgctgcgctcggacgcggaggaagaatttcggccggaaaacgccatcctggtggtgcgg
atccagttctgggcgatcgaggtggccagaaaccgggaggggcataacgatatcgtacgg
atgaagttccgcgggagaaatgtaaacagagatgtggaataa

DBGET integrated database retrieval system