KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP007648
Entry
AgaP_AGAP007648   CDS       T01036                                 
Symbol
PRIC1_ANOGA
Name
(RefSeq) AGAP007648-PA
  KO
K04511  prickle
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    AgaP_AGAP007648 (PRIC1_ANOGA)
SSDB
Motif
Pfam: PET LIM Metallothio_Pro Vasculin
Other DBs
NCBI-GeneID: 1269578
NCBI-ProteinID: XP_308221
VectorBase: AGAP007648
UniProt: Q7QJT4
Position
2L
AA seq 923 aa
MSYPYQKSHHQTQQPQQNGHPQHQLMLQQQQQADHSPHHHHHHHVHHATAHAYPYELGRS
PLRSPQSPPLYSGKPPPPPPQSYHSYQQPPTAAHPPVSLSGAPTSMPGMMPGQQPPGMTL
SLGGGGGGGGGGSAGDCFMLPPLQPQSPDGLSTVTNTSSTATNAPSARSVYPQHHQPSYP
SIGSSHHPFHSPASAAALIGPSMPQHAQQQQQHQMQPHHYSSMHLLGPAGGPPSSVGPAS
MVGMMGPGGHGGGGVGGGAGGIAGGVGGGPGGGMGGGHNYSQSDDDSGCALEEYTWVPPG
LRPDQVHLYFSAIPEDKVPYVNSIGERHRVRQLLQQLPPHDNEVRYCHSLTDEERKELKL
FSAQRKREALGRGTVKQITTTLICERCGECASSGDMMVFASRFEPNTCWHPACFACCVCK
ELLVDLIYFHRENRLYCGRHHAETLKPRCSACDEIILADECTEAEGRAWHIKHFACFECD
KQLGGQRYIMRDGKPYCLHCFDAMFAEYCDYCSEPIGVDQGQMSHDGQHWHATDQCFACS
TCRCSLLGRPFLPRRGEIYCSIACSKGEPPTPSDEYAHRSSQPSHTAARSPEPLRSPERG
TGRLSPPHTEHEVQSHEAASTVGSDRDHQLRSPASNGTATDNGTGTAGGGVGDSNRHRIP
HRQPLDLTDLGHSLEQHWQSERTGSETISITTATATVRTQVTGPIAGANGNGPTGGGPIL
TSSMPELNRCLAAAGSGESPSFSGTNSPTPMPIEDSVVANGGDDADEQNQNASDASHSIK
EVRFEGDFQDSLPRTKSYCQRNGGQRNRAAKSSSYASDDDELAEDETDNYHHRRHHHSHQ
REQQRPVDDSDARSVCSTCSSSSSSADDDVYELPLRRTSYGGTRIHYMPNNSLACARKRK
QLQTSSGVAGQHYEKDNKNCIIS
NT seq 2772 nt   +upstreamnt  +downstreamnt
atgtcgtatccataccaaaaatcccatcatcaaacgcagcagccgcagcagaacgggcac
ccgcagcatcagctgatgctgcaacagcaacagcaggctgatcattcgccccatcatcat
catcatcatcacgtccatcatgcgaccgcccatgcctacccgtacgagttgggtcgcagc
ccactgcgcagcccccaatcgccccccttgtacagtgggaaaccgccaccaccgccaccc
cagtcctaccactcctatcagcaaccgccaacagcagcccatccgcccgtatcactctcg
ggagctccgacaagcatgccgggcatgatgccaggacaacagccacccgggatgaccctt
tcgcttggtggtggtggtggtggtggtggaggtggcagtgcgggagattgctttatgttg
ccaccactccaaccccaatcgcccgacggactgtcgacagtgacgaacacgagcagtacg
gccacgaatgctccctcggcacgctccgtctacccgcagcatcatcagccgtcgtacccc
tcgatcggatcgtcccaccatccgttccattcgccggcatcggcagccgccctgatcgga
ccatcgatgccacagcacgcacagcagcagcagcagcaccaaatgcagcctcaccactac
tcctcgatgcatctgctcggtccggccggtgggccaccgtcctccgttgggccggccagc
atggtcggcatgatgggaccgggtggacatggtggtggtggtgttggcggaggagcaggt
ggaatcgcaggtggtgttggcggtggaccgggcggcggcatgggcggaggtcataactac
tcgcagtcggacgacgacagtggctgcgcactggaggagtacacctgggtgccgcccggg
ttacgtccggatcaggtccatctgtacttttccgccatcccggaggacaaggtgccgtac
gtaaacagtatcggcgagcggcatcgcgttcgacagctgctgcagcagcttccaccgcac
gataatgaggttcgctactgtcactcgctgacggatgaggagcgcaaagagctgaaactg
ttctcggcccagcgcaagcgggaagcgttgggccgcggcacggtcaagcagataacgacc
accttaatatgcgaacggtgtggcgagtgtgcgtcttccggcgacatgatggtgtttgca
tcacggttcgagcccaacacctgctggcatccggcctgcttcgcctgctgcgtctgcaag
gagctgctggtcgacttgatctacttccaccgggagaatcggctgtactgtggccggcat
catgccgaaacgctcaaaccacgttgctccgcctgtgatgagattatcctggccgatgag
tgcaccgaagcggaaggacgagcgtggcacatcaagcactttgcttgtttcgagtgcgac
aaacagcttggaggacagaggtacattatgcgtgatgggaaaccttactgtttgcactgc
ttcgacgccatgtttgcggaatactgtgactactgcagcgaaccgatcggcgtcgatcag
ggccagatgagccacgatgggcagcactggcatgcgacggatcagtgtttcgcctgcagc
acctgtcgctgttcgctgctcgggcgtccgttcttgccgcgtcggggggaaatctattgc
tcaattgcctgcagcaagggtgagccaccgacaccttccgacgagtatgcccatcgaagc
tcacagccgtcccacactgcagcccgttcaccggaaccgttacgaagtcccgaacgaggc
acgggacgcctttcacctccgcacacggaacacgaagtacaaagccatgaagccgccagc
accgtcggaagcgatcgtgaccatcagctgcgcagtcccgcttccaatgggacggcaacg
gacaacggtacggggacggcgggtggcggtgtaggcgattcgaaccggcaccgtattcca
catcgtcaaccgctggatctgaccgacctggggcacagtttggaacagcactggcagtcg
gagcgtacgggaagtgaaacgatctcgatcactacggctactgctacggtaagaacgcag
gtgacgggaccgattgccggtgctaatggaaatggtccaaccggtggtggaccaatccta
acgtcctcaatgccggagctgaaccgatgtttagcggcagcgggctcgggtgaatcgccg
agcttcagtggtaccaacagtccgacgccgatgccgatcgaggacagtgtcgttgcgaac
gggggcgacgatgcggacgaacagaaccaaaacgcctcggacgcgtcccattcgatcaag
gaagttcgatttgagggagatttccaagactcgctgccccgcaccaagagctactgccag
cggaacggtggacagcgtaaccgggcagccaaatcaagcagctacgcatcggatgacgat
gagctggccgaggacgaaacggacaactaccaccatcggcgccatcatcattcgcatcag
cgcgagcagcagcgcccggtggatgattcggatgcgcgcagcgtctgctccacctgctct
tccagctcgtccagtgccgatgacgatgtgtacgagctgcccctgcgccgcacctcatac
ggtggcacgaggatacactatatgccaaacaactcgctggcctgcgctagaaagcggaag
cagctgcagacgtcttccggtgtcgccggtcagcattatgagaaggacaataagaattgt
atcatatcgtag

DBGET integrated database retrieval system