KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007827
Entry
AgaP_AGAP007827   CDS       T01036                                 

Name
(RefSeq) AGAP007827-PA
  KO
K01689  enolase [EC:4.2.1.11]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00010  Glycolysis / Gluconeogenesis
aga01100  Metabolic pathways
aga01200  Carbon metabolism
aga01230  Biosynthesis of amino acids
aga03018  RNA degradation
Module
aga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aga_M00002  Glycolysis, core module involving three-carbon compounds
aga_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AgaP_AGAP007827
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AgaP_AGAP007827
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aga03019]
    AgaP_AGAP007827
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aga04147]
    AgaP_AGAP007827
Enzymes [BR:aga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     AgaP_AGAP007827
Messenger RNA biogenesis [BR:aga03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AgaP_AGAP007827
Exosome [BR:aga04147]
 Exosomal proteins
  Proteins found in most exosomes
   AgaP_AGAP007827
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-GeneID: 1278131
NCBI-ProteinID: XP_317672
VectorBase: AGAP007827
UniProt: Q7Q3D8
Position
3R:1483634..1486754
AA seq 433 aa
MPFKSIKARQIFDSRGNPTVEVDLVTDLGLFRAAVPSGASTGVHEALELRDNEKANWHGK
GVLKAVENINKIIAPAVLSSNLCVTQQKELDELMLKLDGTENKSKLGANAILGVSLAICK
AGAAKKGVPLYKHIADLAGNGNIILPVPAFNVINGGSHAGNKLAMQEFMILPTGASSFTE
AMKIGSEVYHHLKNVIKAKFGLDATAVGDEGGFAPNILENKEALNLIQDAIAKAGYTGKV
EIGMDVAASEFHKEGKYDLDFKNPKSDPSAWLTPDALEQMYQGFIKDFPIVSIEDPFDQD
HWDAWSKITANTTIQIVGDDLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESINAHLL
AKKNGWGTMVSHRSGETEDTFIADLVVGLSTGQIKTGAPCRSERLAKYNQILRIEEELGA
GAKFAGKSFRHPQ
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgccgttcaagagtattaaggcccgtcagatcttcgactcccgtggcaacccgaccgtc
gaggttgacctggtcaccgacctgggactgttccgtgctgccgtcccgtctggtgcgtcc
accggcgtccacgaggcgctggagctgcgcgacaacgagaaggccaactggcacggcaag
ggtgtcctgaaggcggttgagaacatcaacaagatcattgccccggctgtgctgagctcc
aacctttgcgttacccagcagaaggagctcgacgagctgatgctgaagcttgacggaacc
gagaacaagtcgaagctcggtgccaacgctattctgggcgtttcgttggccatctgcaag
gccggcgctgccaagaagggagtcccgctgtacaaacacatcgctgatctcgctggcaat
ggcaacatcatcctgccggtgccggccttcaacgtcatcaacggtggtagccacgccggc
aacaagctggccatgcaggagttcatgatcctgccgaccggtgcgtcgtcctttaccgag
gcgatgaagatcggcagcgaggtgtaccaccacctgaagaacgtcatcaaggccaagttc
ggtctggacgcgacggccgtcggtgatgagggcggcttcgcccccaacatcctggagaac
aaggaagcgctgaacctgatccaggacgccatcgccaaggccggctacaccggcaaggtc
gagatcggcatggacgtggccgcgtccgagttccacaaggagggcaagtacgatctggac
ttcaagaacccgaagtcggacccgagcgcctggttgacgcccgacgcgctggagcagatg
taccagggcttcatcaaggacttcccgatcgtgagcattgaggatcccttcgaccaggac
cactgggacgcgtggagcaagatcactgccaacaccacgatccagatcgtcggcgacgat
ctgaccgtcaccaacccgaagcgcattgccacggccgtcgagaagaaggcctgcaactgt
ctgctgctgaaggtgaaccagatcggctcggtcacggagtcgatcaatgcccatctgctg
gcgaagaagaacggctggggcaccatggtgtcgcatcgctccggcgagaccgaggacacg
ttcattgccgatctggtcgtcggtctgagcacgggccagatcaagaccggcgcaccgtgc
cgatcggagcgtttggccaagtacaaccaaattctgcgcatcgaggaggagctcggcgct
ggcgcgaagttcgccggcaagagcttccgccatccgcagtaa

DBGET integrated database retrieval system