KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007871
Entry
AgaP_AGAP007871   CDS       T01036                                 

Definition
(RefSeq) AGAP007871-PA
  KO
K11518  mitochondrial import receptor subunit TOM40
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aga03029]
    AgaP_AGAP007871
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aga02000]
    AgaP_AGAP007871
Mitochondrial biogenesis [BR:aga03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    AgaP_AGAP007871
Transporters [BR:aga02000]
 Other transporters
  Primary active transporters [TC:3]
   AgaP_AGAP007871
SSDB
Motif
Pfam: Porin_3 OMP_b-brl_3
Other DBs
NCBI-GeneID: 1278084
NCBI-ProteinID: XP_317621
VectorBase: AGAP007871
UniProt: Q7Q3H1
Position
3R
AA seq 334 aa
MGNVLASSKPIAGPGGLPPPMPTEALPAVGGDGAGSPDKPSGESKPLENPGTMEELHRKC
KDVMPVNFEGAKLMINKGLSNHFQVSHTINLNSSNTSGYRFGAMYVGTKQLSPTEAFPVV
LGDIDPSGNLNANIIHQLTPKVRCKFASQIQSSKVTAAQLTTDYKGPNYTTSLTIGNPNI
INNSGVVVAHYLQAVTNKLAMGGEFAYQYGPAVPGGQIALMSAAARYATDLYTWSGTVGA
AGVHLCYYQRASEQLQIGAEVETSFRMQESVATIGYQVDLPKSDLVFRGMLDSNWTVGAV
LEKKLQPLPFTFALSGMLNHTKNQFRLGCGLIVG
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgggtaacgtgttggcttcctctaaaccgatcgctggccccggtggtctgcctccaccg
atgcccacagaagcgctccccgctgttggaggcgatggggccggctcaccggataagcca
tccggcgaatcaaaaccactggaaaacccgggcaccatggaagagctacacaggaaatgc
aaagatgtgatgccagtaaactttgaaggagcgaaactgatgatcaacaagggcttgagc
aaccattttcaggtatcgcacacgattaatctgaattcctcgaatactagcggctaccgg
ttcggcgcgatgtacgtcggcacgaagcagctgtccccgaccgaagcattccccgtcgta
ctgggtgacattgatccgtcgggaaacctgaatgcaaacatcattcaccagctgacaccg
aaggttcggtgtaaattcgcatcacagatccaaagcagtaaggtaacggcggcacaactt
acgacagattacaagggcccgaactacacaacctcgctcaccatcggcaacccgaacatt
atcaacaattccggcgtcgtggtggcacattacctgcaggcggtcacgaacaaattggcc
atgggcggagagtttgcgtaccagtacggaccggcggtacctggtggacagattgctctc
atgtcggctgctgccagatacgctaccgacttgtacacttggtccggcacggtaggggcg
gccggtgtgcacctttgctactatcagcgggccagcgagcagctgcagattggcgccgag
gtggaaactagcttccggatgcaggaatccgtcgctaccatcggctaccaagtggacctg
cccaagtcggatctggtgttccgcggcatgctggacagcaactggacggtgggagccgtg
ctggagaagaagctacagccgctacctttcacctttgcgctcagcggcatgttgaatcac
actaaaaatcagttccggctcgggtgtgggttgatcgtcggttaa

DBGET integrated database retrieval system